Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17070 66 / 3e-14 Peroxidase family protein (.1) AT2G18980 48 / 6e-08 Peroxidase superfamily protein (.1) AT5G14130 47 / 1e-07 Peroxidase superfamily protein (.1) AT4G33870 46 / 5e-07 Peroxidase superfamily protein (.1) AT4G30170 45 / 6e-07 Peroxidase family protein (.1) AT1G68850 45 / 8e-07 Peroxidase superfamily protein (.1) AT3G03670 45 / 1e-06 Peroxidase superfamily protein (.1) AT4G31760 44 / 2e-06 Peroxidase superfamily protein (.1) AT2G18140 44 / 2e-06 Peroxidase superfamily protein (.1) AT5G17820 44 / 3e-06 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G195600 [exp] 51 / 8e-09 AT1G71695 460 / 4e-163 Peroxidase superfamily protein (.1) Potri.002G065300 [exp] 50 / 2e-08 AT1G71695 468 / 2e-166 Peroxidase superfamily protein (.1) Potri.012G076500 [exp] 49 / 3e-08 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1) Potri.006G069600 [exp] 49 / 4e-08 AT2G41480 498 / 6e-179 Peroxidase superfamily protein (.1) Potri.018G131600 [exp] 48 / 6e-08 AT2G41480 478 / 4e-171 Peroxidase superfamily protein (.1) Potri.001G182400 [exp] 47 / 1e-07 AT4G33870 254 / 2e-79 Peroxidase superfamily protein (.1) Potri.017G064100 [exp] 47 / 2e-07 AT5G67400 372 / 2e-129 root hair specific 19 (.1) Potri.005G195700 [exp] 47 / 2e-07 AT1G71695 453 / 2e-160 Peroxidase superfamily protein (.1) Potri.007G067200 [exp] 46 / 3e-07 AT4G33870 253 / 2e-80 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001442 [exp] 50 / 2e-08 AT4G30170 475 / 7e-170 Peroxidase family protein (.1) Lus10005681 [exp] 49 / 6e-08 AT5G17820 294 / 9e-99 Peroxidase superfamily protein (.1) Lus10013065 [exp] 48 / 1e-07 AT1G68850 431 / 2e-152 Peroxidase superfamily protein (.1) Lus10026748 [exp] 47 / 2e-07 AT5G19890 402 / 6e-141 Peroxidase superfamily protein (.1) Lus10029094 [exp] 47 / 2e-07 AT1G68850 439 / 1e-155 Peroxidase superfamily protein (.1) Lus10028689 [exp] 46 / 3e-07 AT1G71695 328 / 4e-114 Peroxidase superfamily protein (.1) Lus10025535 [exp] 46 / 5e-07 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1) Lus10020826 [exp] 45 / 7e-07 AT2G41480 375 / 1e-130 Peroxidase superfamily protein (.1) Lus10012684 [exp] 45 / 7e-07 AT2G41480 395 / 2e-138 Peroxidase superfamily protein (.1) Lus10018375 [exp] 45 / 9e-07 AT5G17820 293 / 1e-98 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G006350.1 pacid=42795966 polypeptide=Potri.004G006350.1.p locus=Potri.004G006350 ID=Potri.004G006350.1.v4.1 annot-version=v4.1 ATGGGAAATGTTTCTCTGATTTTTATGTTAGTGGTGGTAGTGTTAGCGATCAGAGTTGGTGTTGGCCAATCCCAGCTTACATATGATTACTACAGATCTT CGTGTCTAAATGTGGAAACTATAGTTAGGCAAGAAATGCTAGGCATTTTCTTGGTGGATGTTACAGCACCAGCTGCTTTTCTTAGGCTCATGTTCCATGA CTGCCAAGTTCAGGTTAAAAAAAATTATATTTCCTTGTTTGTTCTCTGCTTAGAAAAAATATGGTAA
AA sequence Show only first row Show all	>Potri.004G006350.1 pacid=42795966 polypeptide=Potri.004G006350.1.p locus=Potri.004G006350 ID=Potri.004G006350.1.v4.1 annot-version=v4.1 MGNVSLIFMLVVVVLAIRVGVGQSQLTYDYYRSSCLNVETIVRQEMLGIFLVDVTAPAAFLRLMFHDCQVQVKKNYISLFVLCLEKIW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G17070			Peroxidase family protein (.1)		Potri.004G006350 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Potri.001G413000 [exp]	2.00	0.9159
					Potri.001G225804 [exp]	3.00	0.9081
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.004G084233 [exp]	5.47	0.8536
AT1G23080		PIN7, ATPIN7	ARABIDOPSIS PIN-FORMED 7, Auxi...		Potri.014G146800 [exp]	12.32	0.8328	PIN15
AT5G62000	ARF	ORE14, HSS, ARF...	ORESARA 14, HLS1 SUPPRESSOR, A...		Potri.002G207050 [exp]	12.96	0.8071
AT1G72970		HTH, EDA17	HOTHEAD, embryo sac developmen...		Potri.001G200800 [exp]	16.73	0.9020	ACE.2
					Potri.005G099050 [exp]	21.56	0.7799
					Potri.010G146200 [exp]	29.24	0.7909
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.017G046200 [exp]	47.05	0.8289
AT2G38540		ATLTP1, LP1	ARABIDOPSIS THALIANA LIPID TRA...		Potri.004G086500 [exp]	53.57	0.8149

Compare expression of checked genes

Potri.004G006350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.