Potri.004G006700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35735 155 / 6e-45 Auxin-responsive family protein (.1)
AT3G25290 147 / 4e-42 Auxin-responsive family protein (.1.2)
AT5G47530 145 / 4e-41 Auxin-responsive family protein (.1)
AT4G17280 143 / 3e-40 Auxin-responsive family protein (.1)
AT4G12980 137 / 2e-38 Auxin-responsive family protein (.1)
AT3G07570 112 / 4e-29 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT2G04850 110 / 4e-28 Auxin-responsive family protein (.1)
AT3G61750 102 / 3e-25 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT3G59070 98 / 2e-23 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G54830 54 / 5e-08 DOMON domain-containing protein / dopamine beta-monooxygenase N-terminal domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G024700 181 / 9e-55 AT5G47530 199 / 7e-60 Auxin-responsive family protein (.1)
Potri.014G162000 150 / 2e-43 AT5G47530 369 / 2e-126 Auxin-responsive family protein (.1)
Potri.010G156200 150 / 3e-43 AT5G47530 472 / 1e-166 Auxin-responsive family protein (.1)
Potri.010G156600 150 / 5e-43 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
Potri.002G222700 149 / 9e-43 AT5G35735 369 / 8e-126 Auxin-responsive family protein (.1)
Potri.002G249300 149 / 9e-43 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.016G010900 149 / 9e-43 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1)
Potri.006G015000 148 / 4e-42 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Potri.001G031600 116 / 2e-30 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000915 186 / 2e-56 AT3G25290 205 / 2e-61 Auxin-responsive family protein (.1.2)
Lus10021553 155 / 1e-46 AT3G25290 165 / 5e-49 Auxin-responsive family protein (.1.2)
Lus10025877 155 / 7e-46 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10012350 156 / 3e-45 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10001734 156 / 3e-45 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10038225 150 / 1e-44 AT3G25290 283 / 6e-95 Auxin-responsive family protein (.1.2)
Lus10002274 154 / 2e-44 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10006398 150 / 5e-44 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1)
Lus10017564 141 / 2e-39 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10010498 133 / 2e-36 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.004G006700.1 pacid=42794126 polypeptide=Potri.004G006700.1.p locus=Potri.004G006700 ID=Potri.004G006700.1.v4.1 annot-version=v4.1
ATGAGCTCTCATTGTCTTGTAATCCTCTGTTTAATCCTGTGTGTCCAAAGCTCTTCATGCAGCGAGGGTTCTCTTGTGACAACAGTGAGAAGAACTAATG
AGTGGCAAGTCAGCTCCAGTGTGGAAAACATCAAACCACAAAGGGATGATCATACTTCTCTTCGAGGTACTGAGAATGCAGAGACGACGAACCTAAGATC
ATGGAGTGGTCAAATTGCTTTGCATCACAGACGCCATCTTAGGAATACTCATGGGGTTCTAAACATCATAGGATGGGGAACACTCTTGCCAGTGGGGGCG
ATTGTTGCAAGATCCTTCAGGAAATTTCCATTGAAATGTGATGAATGGTACAAATTTCACGTTCTGTGTCAAACTTTGGGATATATTATTGGTGCAGTAG
GATGGAGCTTTGGGATGTGGCTTGGGAATTCCTCAAAGCAATACAGCTTGAGAGCACACAGGATTCTTGGCATCGTTATTTTCACATTTGCAACTGCACA
GATGCTTGCTCTCTACTTGCAACCGAAGAGAGAGAATGAATGCAGGAGGTGGTGGAAGATATACCATAAAATCCTAGGATATCTATTGATTTCCATGATT
GTAGCAAACATATTTCAAGGGATTGATCATAAAGACCATGCTGAGAAATGGAAATGGATTTATGTAGGAATACTTTCAGTTTTATCATTTAGTGCTCTAG
TGTTGGAGATTCTTCGATTTGTCATGCCTAGAATTCACCGGTAG
AA sequence
>Potri.004G006700.1 pacid=42794126 polypeptide=Potri.004G006700.1.p locus=Potri.004G006700 ID=Potri.004G006700.1.v4.1 annot-version=v4.1
MSSHCLVILCLILCVQSSSCSEGSLVTTVRRTNEWQVSSSVENIKPQRDDHTSLRGTENAETTNLRSWSGQIALHHRRHLRNTHGVLNIIGWGTLLPVGA
IVARSFRKFPLKCDEWYKFHVLCQTLGYIIGAVGWSFGMWLGNSSKQYSLRAHRILGIVIFTFATAQMLALYLQPKRENECRRWWKIYHKILGYLLISMI
VANIFQGIDHKDHAEKWKWIYVGILSVLSFSALVLEILRFVMPRIHR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G35735 Auxin-responsive family protei... Potri.004G006700 0 1
AT1G67260 TCP TCP1 TCP family transcription facto... Potri.017G112000 1.73 0.9157
AT5G22580 Stress responsive A/B Barrel D... Potri.004G187500 3.46 0.9254
AT5G22580 Stress responsive A/B Barrel D... Potri.009G148100 6.32 0.9144
AT1G75710 C2H2ZnF C2H2-like zinc finger protein ... Potri.002G087500 6.92 0.8931
AT3G50180 Plant protein of unknown funct... Potri.016G040000 8.12 0.8516
AT5G09810 ACT2/7, ACT7 actin 7 (.1) Potri.001G453600 8.30 0.8642
AT1G60870 MEE9 maternal effect embryo arrest ... Potri.006G003600 9.89 0.8822
AT5G01310 bHLH APTX, bHLH140 APRATAXIN-like (.1) Potri.006G102600 11.40 0.8910
AT4G15140 unknown protein Potri.011G108700 12.00 0.8704
AT1G53380 Plant protein of unknown funct... Potri.001G387700 13.78 0.8699

Potri.004G006700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.