Potri.004G006900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
AT1G50720 78 / 9e-19 Stigma-specific Stig1 family protein (.1)
AT4G26880 74 / 3e-17 Stigma-specific Stig1 family protein (.1)
AT5G55110 66 / 3e-14 Stigma-specific Stig1 family protein (.1)
AT1G50650 61 / 2e-12 Stigma-specific Stig1 family protein (.1)
AT1G53130 60 / 9e-12 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G007000 142 / 4e-44 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 139 / 8e-43 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.004G007200 132 / 3e-39 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 128 / 1e-38 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.004G006800 120 / 1e-35 AT1G11925 80 / 1e-19 Stigma-specific Stig1 family protein (.1)
Potri.004G030900 119 / 7e-35 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1)
Potri.011G009100 116 / 6e-34 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Potri.011G008804 116 / 8e-34 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1)
Potri.011G009000 115 / 1e-33 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012679 95 / 3e-25 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10020831 94 / 6e-25 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10011146 70 / 1e-15 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10043047 70 / 2e-15 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10011117 66 / 6e-14 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10041930 62 / 2e-12 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10000696 62 / 5e-12 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10005544 58 / 1e-11 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10006512 47 / 3e-07 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Potri.004G006900.1 pacid=42793940 polypeptide=Potri.004G006900.1.p locus=Potri.004G006900 ID=Potri.004G006900.1.v4.1 annot-version=v4.1
ATGAAGTCATCAACAACTTTGTTTACCTTGCTAGTGCTTATAGCCTTAGCCAACATTCAATCAGCAACACCAATGGTTAAACAATCCCATGTTAGCATAG
AAAAACATAGCACCAATGACCTTCCCTTGCAAAGAGATGAGGAACAACCACATCTCCTTAGAAGTGGTCGTTTCCTAGCTAGTAAAGTGACCATGAAATG
TGACAAGTACCCCCCAATTTGTCGTGCCAAAGGAAGTGCTGGGCCTGACTGCTGCAGAAAACAGTGTGTTAATGTGATGTCCGACAAGCTTAATTGTGGC
AAGTGTGGCAAAAAATGCAAGTATTCAGAGATGTGTTGTCAAGGGAAGTGTGTTAACCCTTCTGTTGATGAGAAACACTGTGGCAAGTGTAACCAAAAGT
GCAAAAAGGGAAGCTCTTGTTTGTATGGATTGTGTAGCTATGCTAATTAA
AA sequence
>Potri.004G006900.1 pacid=42793940 polypeptide=Potri.004G006900.1.p locus=Potri.004G006900 ID=Potri.004G006900.1.v4.1 annot-version=v4.1
MKSSTTLFTLLVLIALANIQSATPMVKQSHVSIEKHSTNDLPLQRDEEQPHLLRSGRFLASKVTMKCDKYPPICRAKGSAGPDCCRKQCVNVMSDKLNCG
KCGKKCKYSEMCCQGKCVNPSVDEKHCGKCNQKCKKGSSCLYGLCSYAN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G11925 Stigma-specific Stig1 family p... Potri.004G006900 0 1
AT4G37760 SQE3 squalene epoxidase 3 (.1) Potri.012G121320 3.16 0.9850
AT5G44440 FAD-binding Berberine family p... Potri.011G158100 4.00 0.9847
Potri.018G091032 5.29 0.9787
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Potri.014G014000 5.91 0.9782
AT3G61510 AT-ACS1, ACS1 ARABIDOPSIS THALIANA 1-AMINOCY... Potri.002G163700 6.70 0.9820 Pt-ACS1.3
AT4G28940 Phosphorylase superfamily prot... Potri.006G161538 11.40 0.9701
Potri.011G081701 11.53 0.9598
AT5G63380 AMP-dependent synthetase and l... Potri.010G057000 11.95 0.9657 Ptr4CL12
AT4G37980 ELI3-1, ATCAD7 CINNAMYL-ALCOHOL DEHYDROGENASE... Potri.001G268600 14.83 0.9562 CADL9,CAD.6
AT4G37290 unknown protein Potri.005G142900 15.49 0.9635

Potri.004G006900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.