Potri.004G007900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 260 / 2e-88 B-cell receptor-associated 31-like (.1)
AT1G11905 232 / 2e-77 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 144 / 6e-43 B-cell receptor-associated protein 31-like (.1)
AT3G07190 142 / 2e-42 B-cell receptor-associated protein 31-like (.1)
AT3G20450 117 / 2e-33 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G007200 365 / 6e-130 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.014G154800 217 / 1e-71 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 162 / 8e-50 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 156 / 1e-47 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 139 / 4e-42 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020025 255 / 1e-86 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10031546 221 / 3e-73 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10030043 200 / 2e-65 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10015132 199 / 1e-64 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10035283 187 / 3e-60 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10011842 166 / 2e-51 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10038188 157 / 4e-48 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Lus10022777 154 / 6e-47 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10000048 91 / 2e-23 AT1G11905 81 / 3e-20 B-cell receptor-associated protein 31-like (.1.2)
Lus10025914 53 / 1e-09 AT3G07190 66 / 7e-15 B-cell receptor-associated protein 31-like (.1)
PFAM info
Representative CDS sequence
>Potri.004G007900.1 pacid=42793990 polypeptide=Potri.004G007900.1.p locus=Potri.004G007900 ID=Potri.004G007900.1.v4.1 annot-version=v4.1
ATGATTCAGCTTTTGTTTGCGGTGATATTTTCAGAGATGGCAATGATATTATTATTTGTTTTCAAGTCCCCATTAAGGAAGTTTCTGATAATGAGCTTGG
ATCGACTCAAAAGAGGGCGTGGACCAGTCATGGTTAAGACAGTTGCAGGGACAGTGTTTTTGGTTTTAATCTCAAGTGTTTATAGTATGGTGAAGATCCA
GAAACGTGGGATCGATGTTGGTGGTGTTGTTAATCCTACAGACCAGGTTCTTATGGCTAAACATCTTCTTGAGGCTACTCTTATGGGTTCCATCCTTTTC
CTTTCACTAATGATAGACCGCCTGCACCATTACATCAGAGAGCTTCGTATGCGGAGGAAGAGCATGGAGGCTGTAAAGAAACAAAATCGAAGTTTTGAGG
ATGGGAAGGTTGAGGAGACCAAAGCTTTAGAAACAGAGGTGTCCACACTGCAAGAAAAACTTAAACAGCTGCAATCTGAGCTGGAAGTCAAGTCAAAGGA
GGTAAATACATCAGAAGCCAATGCAGCTGCTCTAAGTAAGCAATCTGAAGGGTTCCTTCTTGAGTATGATCGCTTGCTTGAAGAAAACCAGAACCTACGG
AGCCAGTTGCAATCTATGGACTTGGGACTTTCACGATCAACCAGCAAGAAGAATACTTGA
AA sequence
>Potri.004G007900.1 pacid=42793990 polypeptide=Potri.004G007900.1.p locus=Potri.004G007900 ID=Potri.004G007900.1.v4.1 annot-version=v4.1
MIQLLFAVIFSEMAMILLFVFKSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSVYSMVKIQKRGIDVGGVVNPTDQVLMAKHLLEATLMGSILF
LSLMIDRLHHYIRELRMRRKSMEAVKKQNRSFEDGKVEETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAAALSKQSEGFLLEYDRLLEENQNLR
SQLQSMDLGLSRSTSKKNT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42570 B-cell receptor-associated 31-... Potri.004G007900 0 1
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Potri.011G103700 8.83 0.8350
AT1G16490 MYB ATMYB58 myb domain protein 58 (.1) Potri.005G096600 10.34 0.7535
AT3G62830 ATUXS2, UXS2, A... UDP-GLUCURONIC ACID DECARBOXYL... Potri.002G204400 30.46 0.8114 Pt-UXS2.1
AT4G12590 Protein of unknown function DU... Potri.006G011500 50.61 0.7967
AT4G36750 Quinone reductase family prote... Potri.007G029600 59.39 0.7245
AT4G25030 unknown protein Potri.010G219900 63.37 0.7246
AT3G13930 Dihydrolipoamide acetyltransfe... Potri.003G043900 64.86 0.8028
AT5G25265 unknown protein Potri.018G023100 80.46 0.7229
AT2G24400 SAUR-like auxin-responsive pro... Potri.006G278100 90.86 0.7574
AT3G05950 RmlC-like cupins superfamily p... Potri.011G162932 107.14 0.7479

Potri.004G007900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.