Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G04470 209 / 2e-69 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 205 / 6e-68 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G19750 64 / 2e-12 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT3G24570 54 / 5e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G43140 49 / 4e-07 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G007100 [exp] 294 / 4e-103 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.010G068900 [exp] 164 / 9e-52 AT4G14305 252 / 1e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.004G009201 [exp] 107 / 8e-31 AT4G14305 72 / 2e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.016G029700 [exp] 67 / 1e-13 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.006G032500 [exp] 64 / 4e-12 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.018G081600 [exp] 57 / 3e-10 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G037100 [exp] 56 / 1e-09 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020027 [exp] 241 / 4e-82 AT4G04470 259 / 2e-89 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10011798 [exp] 182 / 7e-59 AT4G14305 262 / 1e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10034922 [exp] 62 / 7e-12 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10023648 [exp] 62 / 1e-11 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10038626 [exp] 59 / 1e-10 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10011679 [exp] 55 / 3e-09 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10039003 [exp] 55 / 4e-09 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10022130 [exp] 51 / 7e-08 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10037900 [exp] 50 / 2e-07 AT3G24570 246 / 3e-82 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10018700 [exp] 49 / 6e-07 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [poplar] [flax] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Potri.004G008700.4 pacid=42794482 polypeptide=Potri.004G008700.4.p locus=Potri.004G008700 ID=Potri.004G008700.4.v4.1 annot-version=v4.1 ATGGGGTCAGTAGCGAAGAGAGGACTGCAACAGTACTTGTTACAGCTTCAACAGCACCCCCTGAGAACTAAGGCAATTACAGCAGGGGTGTTATCAGCTG TCAGTGACATAGTAGCACAGAAACTCTCTGGCATACAGAAACTTCAAATTAAAAGGATTTTGCTCAAAGTGCTTTTTGGGTTTGGATATCTGGGACCATT CGGGCATTTCCTACATTTAATGCTGGAAAAAATGTTCAAGGGAAAGAAGGATACCGCAACAGTTGCCAAGAAGGTGGCTGTGGAGCAGTTGACAGCTTCT CCTTGGAACAACTTGGTTTTCATGATTTATTATGGGATGGTTATTGACGGAAGACCCTGGATGCAAGTGAAAACTAAACTAAAAAAGGAATACCCAGCAG TGCAGTTCACATCATGGACGTTCTGGCCAGTCGTTGGGTGGGTAAATCACCAGTACGTGCCACTGCAGTTTCGTGTTATTTTCCACAGCCTTATCGCAGT AGGCTGGGGAATATTTCTAAATCTCCGAGCAAAGTCAATGGCGTTGACCAAAGGTTAA
AA sequence Show only first row Show all	>Potri.004G008700.4 pacid=42794482 polypeptide=Potri.004G008700.4.p locus=Potri.004G008700 ID=Potri.004G008700.4.v4.1 annot-version=v4.1 MGSVAKRGLQQYLLQLQQHPLRTKAITAGVLSAVSDIVAQKLSGIQKLQIKRILLKVLFGFGYLGPFGHFLHLMLEKMFKGKKDTATVAKKVAVEQLTAS PWNNLVFMIYYGMVIDGRPWMQVKTKLKKEYPAVQFTSWTFWPVVGWVNHQYVPLQFRVIFHSLIAVGWGIFLNLRAKSMALTKG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G04470		PMP22	Peroxisomal membrane 22 kDa (M...		Potri.004G008700 [exp]	0	1
AT3G25640			Protein of unknown function, D...		Potri.010G131600 [exp]	2.00	0.7526
AT4G14305			Peroxisomal membrane 22 kDa (M...		Potri.004G009201 [exp]	2.00	0.8100
AT2G45730			eukaryotic initiation factor 3...		Potri.005G238200 [exp]	2.64	0.7247
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Potri.016G070500 [exp]	10.81	0.7723
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Potri.013G094400 [exp]	16.00	0.6989
AT2G24230			Leucine-rich repeat protein ki...		Potri.006G185100 [exp]	23.49	0.7234
AT1G13380			Protein of unknown function (D...		Potri.008G120900 [exp]	27.92	0.7251
AT3G16300			Uncharacterised protein family...		Potri.001G188000 [exp]	31.93	0.6573
AT5G50150			Protein of Unknown Function (D...		Potri.012G088300 [exp]	33.91	0.6733
AT5G38630		ACYB-1	cytochrome B561-1 (.1)		Potri.017G111700 [exp]	34.42	0.7287

Compare expression of checked genes

Potri.004G008700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.