Potri.004G011701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G011300 194 / 1e-63 ND /
Potri.004G012000 115 / 4e-34 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G011701.1 pacid=42794873 polypeptide=Potri.004G011701.1.p locus=Potri.004G011701 ID=Potri.004G011701.1.v4.1 annot-version=v4.1
ATGGAGGGAATGGCAGGACATGGATGGTTTCTCCCTGCTACTGGAGTACTGGCCACAATTATCCAATTGAAACCTGAAACTCTCACTCCATCTATTATAA
ACGATGCTATCATAACCATGGCTGTTGTTGCTGTGCTCATCCATGTTGTATGCAGTGCATTTGAAGATATACTCGAAGCTGGTCACTTCAGATTAATTGC
TGCCGGCACCGGTCATCTGGCCAGAGCTCTTGCCATTACTCTACTACTCATAATCTGCGTCCCAAAAATTTGGTGGTTTCTTCTTTCCGCATGGGTGTTG
TTCTTTATATGGGTAACATATACTTTACTATACAATGCAGTTCACCTTCGTCAACGCCACGGCCAAGCCCAAGAGCCAAATGAGTTGCCGAATGAGTTGC
CCTAA
AA sequence
>Potri.004G011701.1 pacid=42794873 polypeptide=Potri.004G011701.1.p locus=Potri.004G011701 ID=Potri.004G011701.1.v4.1 annot-version=v4.1
MEGMAGHGWFLPATGVLATIIQLKPETLTPSIINDAIITMAVVAVLIHVVCSAFEDILEAGHFRLIAAGTGHLARALAITLLLIICVPKIWWFLLSAWVL
FFIWVTYTLLYNAVHLRQRHGQAQEPNELPNELP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G011701 0 1
AT5G64560 MRS2-2, ATMGT9 magnesium transporter 9 (.1.2) Potri.010G077900 2.44 0.8732
Potri.004G011101 2.44 0.8725
AT3G13080 EST2, ATMRP3, A... MULTIDRUG RESISTANCE PROTEIN 3... Potri.008G179500 6.32 0.8430
Potri.006G169550 8.06 0.8423
Potri.004G011375 9.16 0.8223
AT1G26660 Prefoldin chaperone subunit fa... Potri.010G163600 9.48 0.8289
AT2G37710 RLK receptor lectin kinase (.1) Potri.009G036450 14.69 0.8218
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Potri.016G111800 15.58 0.7983
AT1G77620 P-loop containing nucleoside t... Potri.002G084700 16.61 0.7640
AT3G22780 CPP ATTSO1, TSO1 CHINESE FOR 'UGLY', Tesmin/TSO... Potri.013G038301 17.54 0.7413

Potri.004G011701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.