Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07900 55 / 2e-10 Mitochondrial transcription termination factor family protein (.1) AT1G21150 45 / 3e-07 Mitochondrial transcription termination factor family protein (.1) AT3G46950 44 / 9e-07 Mitochondrial transcription termination factor family protein (.1) AT1G61960 38 / 0.0002 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G013100 [exp] 114 / 4e-32 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1) Potri.011G005100 [exp] 113 / 1e-31 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1) Potri.010G022700 [exp] 112 / 2e-31 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1) Potri.004G012400 [exp] 112 / 2e-31 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1) Potri.004G012900 [exp] 107 / 1e-29 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1) Potri.004G013000 [exp] 106 / 3e-29 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1) Potri.008G216200 [exp] 89 / 1e-22 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1) Potri.012G046700 [exp] 78 / 9e-19 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1) Potri.015G038500 [exp] 77 / 1e-18 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002883 [exp] 73 / 5e-17 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1) Lus10040820 [exp] 69 / 1e-15 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1) Lus10016550 [exp] 68 / 3e-15 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1) Lus10016553 [exp] 66 / 2e-14 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1) Lus10040817 [exp] 65 / 4e-14 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1) Lus10004957 [exp] 63 / 2e-13 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1) Lus10008688 [exp] 48 / 6e-08 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1) Lus10002881 [exp] 45 / 7e-07 AT5G07900 72 / 1e-14 Mitochondrial transcription termination factor family protein (.1) Lus10036450 [exp] 41 / 2e-05 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1) Lus10028912 [exp] 39 / 9e-05 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [poplar] [flax] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Potri.004G012300.2 pacid=42793771 polypeptide=Potri.004G012300.2.p locus=Potri.004G012300 ID=Potri.004G012300.2.v4.1 annot-version=v4.1 ATGAGCAGATCCACATGGGAAAAGAAGCTTGCTGTGTATAGGAGGTGGGGTTTGTCCGAAGAGGAAATTCTTGCGTCATTTGTAAAGTTTCCATGGTTTA TGGCCCTATCTGAAGAGAAGATCATGGCACTGATGGATCTTTTTGTCCACAAATTGGGCTGGGAGGCGTTCTATCTTGCCAAAAACCCATCAATTGCATC GAATGGCATGTAG
AA sequence Show only first row Show all	>Potri.004G012300.2 pacid=42793771 polypeptide=Potri.004G012300.2.p locus=Potri.004G012300 ID=Potri.004G012300.2.v4.1 annot-version=v4.1 MSRSTWEKKLAVYRRWGLSEEEILASFVKFPWFMALSEEKIMALMDLFVHKLGWEAFYLAKNPSIASNGM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07900			Mitochondrial transcription te...		Potri.004G012300 [exp]	0	1
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	3.46	0.8939
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	5.09	0.8837
					Potri.010G080633 [exp]	6.24	0.8681
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	7.48	0.8616
					Potri.005G187000 [exp]	7.74	0.8564
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	9.53	0.8480
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	9.79	0.8512
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	9.94	0.8185
AT5G45470			Protein of unknown function (D...		Potri.015G107950 [exp]	10.24	0.6999
AT5G36930			Disease resistance protein (TI...		Potri.010G231250 [exp]	10.48	0.8136

Compare expression of checked genes

Potri.004G012300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.