Potri.004G013000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 159 / 1e-44 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 148 / 1e-40 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 142 / 3e-38 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 141 / 7e-38 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 141 / 1e-37 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 130 / 9e-34 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 130 / 1e-33 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 126 / 4e-32 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G012400 630 / 0 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 621 / 0 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 615 / 0 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 546 / 0 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 414 / 6e-144 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 345 / 1e-116 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 271 / 4e-88 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046800 253 / 4e-81 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 253 / 6e-81 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002883 244 / 2e-77 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 214 / 1e-65 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 202 / 3e-61 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 201 / 1e-60 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 191 / 6e-57 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 162 / 5e-46 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 140 / 3e-39 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 134 / 1e-36 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 123 / 2e-31 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 110 / 1e-27 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.004G013000.1 pacid=42795169 polypeptide=Potri.004G013000.1.p locus=Potri.004G013000 ID=Potri.004G013000.1.v4.1 annot-version=v4.1
ATGTTTAGATTACCCTGCAAAAGCATAGTGACAGGGTCCTCTGTTAGAGCTTCATCAGTTCATTCTTTTCTTGAAAACCCTTCAATATTATCATGTCTCA
GATACATCTCATCAGTGAATACAGATGATGATATAAAAGAACATTCCTTTACAGTCTCATACCTTATGAACAAATGTGGGTTCTCTCTAAAATCTGCTTT
AGAAGTTTCTAAACAGGTTCATTTTGAAACCCCAGATAAGCCTGATTCTGTTCTTGCCGTTTTCAAGAACTATGGTTTCTCAAAATCCCAAATTTTGAAC
CTTGTGAGGAGACGGCCACCGGTGCTTTTGTCTAGACCTAACACAACACTTTTGCCCAAGCTTGAGTTTTTCCAATCTAAAGGTTTTTCCAGCCATGATG
TTATCAAAATCATATCATCCTACCCATGGGTTTTGATGTACAGCTTAGAAAACAAATTAGTCCCTGCTTTTGATTTCCTTGAAAACTTGCTCCAATCTGA
TGCCGTGGTCATCATAGTAATCATGCGCTCCCCTCGTATTCTAAATAGTAATGTTGAAAACATGGCACGTATTGTTGATGTTTTACAAGGCAATGGAGTC
CCTAAAAAGAATATTGCTCTGCCAATTCGTTGCCAGCCTTCTATTATGATTTCAAATCTGGAGAATTTTAAAAAGCTTATAGAGGAAGTGACTCTAATGG
GATTTCATCCTTCCAAGAGTCAATTTGTTTCTGCAATCACAGTGCTGAGGTCCATGAGCGGATCCACTTGGGAAAAGAAGCTTACTGTGTATAGGAGATG
GGGTTTGTCTGAAGAAGAAATTCTTACAGCATTTGTAAAATTTCCAATGTTTATGCGCAAATCTGCAGAGAAGATCGCAGCATCAATGGATCTTTTTGTC
AACAAATTAGGGTGGGAGTCGTCCTATCTTGCCAAAAATCCAACTTGCTCATCATATAGCCTTGAGAAAAGGCTAATTCCAAGGGCTTTGGTGTTGCAAT
TTTTAGTTTCTAAACGCTTGGTTGAGAAGAGTTTCAGAAGCCTTGCATTCTTCAATACACCTGAAGATAAGTTCCGGCGGATATTTATAGACCAGCATGC
TGAGTCTACCCAGATATTGAAATTTTACAGGGAAAAACTGAATCTTTCATCAGTTGTAAACTCTTCTACATTTTAA
AA sequence
>Potri.004G013000.1 pacid=42795169 polypeptide=Potri.004G013000.1.p locus=Potri.004G013000 ID=Potri.004G013000.1.v4.1 annot-version=v4.1
MFRLPCKSIVTGSSVRASSVHSFLENPSILSCLRYISSVNTDDDIKEHSFTVSYLMNKCGFSLKSALEVSKQVHFETPDKPDSVLAVFKNYGFSKSQILN
LVRRRPPVLLSRPNTTLLPKLEFFQSKGFSSHDVIKIISSYPWVLMYSLENKLVPAFDFLENLLQSDAVVIIVIMRSPRILNSNVENMARIVDVLQGNGV
PKKNIALPIRCQPSIMISNLENFKKLIEEVTLMGFHPSKSQFVSAITVLRSMSGSTWEKKLTVYRRWGLSEEEILTAFVKFPMFMRKSAEKIAASMDLFV
NKLGWESSYLAKNPTCSSYSLEKRLIPRALVLQFLVSKRLVEKSFRSLAFFNTPEDKFRRIFIDQHAESTQILKFYREKLNLSSVVNSSTF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.004G013000 0 1
AT5G59500 protein C-terminal S-isoprenyl... Potri.001G242400 1.73 0.9211
AT5G19370 rhodanese-like domain-containi... Potri.009G069300 3.46 0.9204
AT3G11570 TBL8 TRICHOME BIREFRINGENCE-LIKE 8 ... Potri.016G074800 10.58 0.9192
AT1G08640 CJD1 Chloroplast J-like domain 1 (.... Potri.013G046200 11.18 0.9185
AT4G01650 Polyketide cyclase / dehydrase... Potri.014G110600 13.30 0.9194
AT4G24175 unknown protein Potri.005G240800 22.84 0.9166
AT5G63100 S-adenosyl-L-methionine-depend... Potri.015G082432 23.66 0.9107
AT3G16190 Isochorismatase family protein... Potri.003G051700 24.55 0.8900
AT3G06730 TRXz, TRXP ,TRX... thioredoxin putative plastidic... Potri.001G028500 24.97 0.9172
AT2G36000 EMB3114 EMBRYO DEFECTIVE 3114, Mitocho... Potri.006G205000 26.83 0.9185

Potri.004G013000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.