Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62045 52 / 2e-10 unknown protein AT1G11740 49 / 3e-08 ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G004400 [exp] 107 / 1e-32 AT1G62045 47 / 2e-08 unknown protein Potri.014G153900 [exp] 49 / 2e-09 AT1G19020 40 / 1e-05 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020036 [exp] 48 / 3e-08 AT1G11740 47 / 2e-07 ankyrin repeat family protein (.1) Lus10027187 [exp] 41 / 3e-06 AT3G48180 43 / 5e-07 unknown protein Lus10039655 [exp] 35 / 0.0004 ND 37 / 2e-04
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G013601.1 pacid=42793907 polypeptide=Potri.004G013601.1.p locus=Potri.004G013601 ID=Potri.004G013601.1.v4.1 annot-version=v4.1 ATGGCAAGTGAGGCTCCCAGCTGGGCAGATCAATGGGGTACAGGAGGCATTGGTTCCATGGAAGAAGACAATTACACGACCAAGCAAGATACCAGCAACG AGAAGAAGTCAGATGGCAAAGGGGGATTAAACAAAGCCAAAGCAGCTGCTATGTCTGGGGCTCAAAAGCTCAAGAGTGGAGCATCCAGTAGCTTCAAATG GGTCAAAAGTAAATGCCAGAAAAAATAA
AA sequence Show only first row Show all	>Potri.004G013601.1 pacid=42793907 polypeptide=Potri.004G013601.1.p locus=Potri.004G013601 ID=Potri.004G013601.1.v4.1 annot-version=v4.1 MASEAPSWADQWGTGGIGSMEEDNYTTKQDTSNEKKSDGKGGLNKAKAAAMSGAQKLKSGASSSFKWVKSKCQKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G62045			unknown protein		Potri.004G013601 [exp]	0	1
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Potri.007G107200 [exp]	2.23	0.9282
AT5G58375			Methyltransferase-related prot...		Potri.013G155800 [exp]	4.00	0.9162
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Potri.009G052700 [exp]	5.19	0.9022	CPK7.1
AT3G08500	MYB	ATMYB83	myb domain protein 83 (.1)		Potri.009G061500 [exp]	6.32	0.9077
AT1G74690		IQD31	IQ-domain 31 (.1)		Potri.012G069900 [exp]	7.34	0.9099
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.016G097800 [exp]	7.41	0.9115	ALPHA.3
AT2G04850			Auxin-responsive family protei...		Potri.002G222600 [exp]	11.40	0.8983
AT3G50760		GATL2	galacturonosyltransferase-like...		Potri.007G031700 [exp]	11.48	0.8994
AT4G22560			unknown protein		Potri.001G121600 [exp]	11.83	0.8845
AT1G34350			unknown protein		Potri.019G085500 [exp]	13.03	0.9012

Compare expression of checked genes

Potri.004G013601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.