Plant FIBer expression Database

Potri.004G013750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.004G013750.1 pacid=42794938 polypeptide=Potri.004G013750.1.p locus=Potri.004G013750 ID=Potri.004G013750.1.v4.1 annot-version=v4.1
ATGGGGTTAATTTGCCCATTATATTCTCTTCTGTATGCTAGATTAAGGCTCTTAATTATGAATATGATCGTGATTTTTGGGTGGAAATTAATGATCATGG
TATGTGTGTACATGTATGGTAAGGTTTTGTGCACCAAGATGGAGACGGGATATGTTGCAGGGTTTTTTCACGTGAAAACATTGATTAAAGTGGGGCTTCG
TTTTCTATTTTATATTTTTTACGGTGAAGGAAAGCTAGGAAAAGACAGCCAATTAATTCACTTGGAGGGAAGGACAGAAGATCTCTGGGGTATAGAGTAT
AGACACAGGCCGATTTTTGGTAGGGTTTGA
AA sequence
>Potri.004G013750.1 pacid=42794938 polypeptide=Potri.004G013750.1.p locus=Potri.004G013750 ID=Potri.004G013750.1.v4.1 annot-version=v4.1
MGLICPLYSLLYARLRLLIMNMIVIFGWKLMIMVCVYMYGKVLCTKMETGYVAGFFHVKTLIKVGLRFLFYIFYGEGKLGKDSQLIHLEGRTEDLWGIEY
RHRPIFGRV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G013750
[exp]
0 1
AT2G23060 Acyl-CoA N-acyltransferases (N... Potri.010G144700
[exp]
5.09 0.9306
AT4G14723 EPFL4, CLL2 epidermal patterning factor li... Potri.008G157300
[exp]
7.74 0.9256
AT2G30370 EPFL6, CHAL EPF1-like 6, CHALLAH, allergen... Potri.013G155500
[exp]
9.59 0.9193
AT4G21750 HD ATML1 MERISTEM LAYER 1, Homeobox-leu... Potri.011G025000
[exp]
10.81 0.9206 Pt-ATML1.1
AT4G31980 unknown protein Potri.013G146300
[exp]
12.24 0.9143
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Potri.001G227400
[exp]
14.07 0.9130
AT2G27240 Aluminium activated malate tra... Potri.001G217200
[exp]
15.23 0.9106
AT1G60060 Serine/threonine-protein kinas... Potri.010G096400
[exp]
18.33 0.8951
Potri.017G142923
[exp]
19.33 0.9016
AT5G04530 KCS19 3-ketoacyl-CoA synthase 19 (.1... Potri.010G212600
[exp]
19.67 0.9101

Potri.004G013750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.