Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G55770 51 / 4e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 44 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G127500 [exp] 164 / 1e-51 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 53 / 1e-08 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G013400 [exp] 52 / 2e-08 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.014G044100 [exp] 49 / 1e-07 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 48 / 7e-07 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.003G086600 [exp] 46 / 3e-06 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.007G108301 [exp] 44 / 2e-05 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001464 [exp] 109 / 3e-30 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 105 / 2e-28 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10041650 [exp] 53 / 1e-08 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10002933 [exp] 48 / 4e-07 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 47 / 8e-07 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 44 / 2e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10038738 [exp] 44 / 2e-05 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10019498 [exp] 44 / 2e-05 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10039120 [exp] 42 / 6e-05 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10027947 [exp] 42 / 7e-05 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.004G016500.1 pacid=42794042 polypeptide=Potri.004G016500.1.p locus=Potri.004G016500 ID=Potri.004G016500.1.v4.1 annot-version=v4.1 ATGAAGCCCGTTACAAGTTTCTTCCTGTTTTCTGCAACTCTAAGCCTCACCTTCTTCTTCCACCCATCAGTGGCCAAAGGACGCACCAACCTAATCCAAG AAGTATGTACAAAAACTCATAACAAGGTTAATTGTGTTGCCAGCCTTGAATCTAACCCTGATAGCAAACAAGCCAATCTACAGCAACTTGGCATAATTGC ATTAAACCTTGCATCAACGAAGGCAACAAACACATCCTTGTACATCAAGACAACATTGCTTAGTAACAAAACTCTGGGCCCTGTCAATGAGCAAGCCCTA GAAGATTGTTCAGATCAATACTTGGATGCCATCCAGCAACTTGATGACTCATTGGCTGCTTTGTTAGCCAATGCTACTAATGATGTGCGTGCTTGGGTGA GAGCAGCAGTTGCTGATGTTGAATCATGCGAGAATGGGTTCAAGAAACAGGTTCCTGGCCAACAAATGTTGCTGTCTTCGAGAAACGCAGTTTTTCGCCA ATTGTGCAACAATGTCTTGGTCATCAACAAACTCTTAAGCCAAACAAGTGCTGGAAGTAATTAA
AA sequence Show only first row Show all	>Potri.004G016500.1 pacid=42794042 polypeptide=Potri.004G016500.1.p locus=Potri.004G016500 ID=Potri.004G016500.1.v4.1 annot-version=v4.1 MKPVTSFFLFSATLSLTFFFHPSVAKGRTNLIQEVCTKTHNKVNCVASLESNPDSKQANLQQLGIIALNLASTKATNTSLYIKTTLLSNKTLGPVNEQAL EDCSDQYLDAIQQLDDSLAALLANATNDVRAWVRAAVADVESCENGFKKQVPGQQMLLSSRNAVFRQLCNNVLVINKLLSQTSAGSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02250			Plant invertase/pectin methyle...		Potri.004G016500 [exp]	0	1
AT4G34780			SAUR-like auxin-responsive pro...		Potri.017G052501 [exp]	3.74	0.6878
AT4G02550			unknown protein		Potri.006G191850 [exp]	10.58	0.6978
AT3G43660			Vacuolar iron transporter (VIT...		Potri.018G106000 [exp]	21.33	0.6403
					Potri.009G019900 [exp]	26.26	0.6081
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Potri.001G037800 [exp]	36.87	0.6468
AT3G01570			Oleosin family protein (.1)		Potri.001G345800 [exp]	38.49	0.6013
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Potri.002G228700 [exp]	56.65	0.5707
AT4G34210		ASK11	SKP1-like 11 (.1)		Potri.012G085200 [exp]	71.38	0.6097
AT3G28050			nodulin MtN21 /EamA-like trans...		Potri.001G032100 [exp]	75.59	0.5984
AT5G48890	C2H2ZnF	LATE	LATE FLOWERING, C2H2-like zinc...		Potri.002G238700 [exp]	100.19	0.5420

Compare expression of checked genes

Potri.004G016500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.