Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70850 66 / 4e-13 MLP34 MLP-like protein 34 (.1.2.3) AT1G70890 63 / 5e-13 MLP43 MLP-like protein 43 (.1) AT1G70840 62 / 1e-12 MLP31 MLP-like protein 31 (.1) AT5G28010 62 / 2e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 61 / 3e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70830 61 / 4e-12 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT2G01530 56 / 2e-10 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1) AT4G23680 56 / 3e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28000 56 / 4e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G020100 [exp] 270 / 3e-94 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G051500 [exp] 116 / 8e-34 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131300 [exp] 58 / 4e-11 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G111000 [exp] 57 / 6e-11 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051200 [exp] 46 / 7e-07 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039863 [exp] 49 / 2e-07 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039893 [exp] 46 / 3e-07 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 46 / 1e-06 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002176 [exp] 45 / 2e-06 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2) Lus10042489 [exp] 45 / 2e-06 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10012466 [exp] 45 / 4e-06 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10020497 [exp] 45 / 4e-06 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10020498 [exp] 44 / 8e-06 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012742 [exp] 43 / 1e-05 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5) Lus10008931 [exp] 40 / 4e-05 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.004G020000.1 pacid=42795607 polypeptide=Potri.004G020000.1.p locus=Potri.004G020000 ID=Potri.004G020000.1.v4.1 annot-version=v4.1 ATGGCTCGCCTTTGCAGAAAAGTCGTGGAAACACCAATTCAATGCTCTACTGATGCTTTCTATAAATTCTTCAAGAAACAAGCAAACTTCTTACCGAATG TCTGCGGTTCTGTTGTGCAGACAATAGGACTCGCTGACGGTAACAAAAGCTGGGTTAATACTGTTGGCTCCCGCAAAATGATTGAAATCCTGTCTTCCGA GTCTTCCCGTGACACTGCGGAGAAAATCAAGTATGTAGTTGAATCCGTTGACGACCGCTCCAGGAAAATCACCTACAAAGTGCTGGAAGGAGCGTTGCTG CAACAGTACGAATCCTTCTCCGTCACTCTACAGGTTACTTCTTCCAGCACCGCGAAATGGACTATCAATTATCAGAAAAAAGATCCTGCCAGCGAAAACC CTGATTTTTACCTCCAACTTTTGCCAACTGTCAACGCTACTGTTGATATTTACCTTCGTTCTAATGATTACTAA
AA sequence Show only first row Show all	>Potri.004G020000.1 pacid=42795607 polypeptide=Potri.004G020000.1.p locus=Potri.004G020000 ID=Potri.004G020000.1.v4.1 annot-version=v4.1 MARLCRKVVETPIQCSTDAFYKFFKKQANFLPNVCGSVVQTIGLADGNKSWVNTVGSRKMIEILSSESSRDTAEKIKYVVESVDDRSRKITYKVLEGALL QQYESFSVTLQVTSSSTAKWTINYQKKDPASENPDFYLQLLPTVNATVDIYLRSNDY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70880			Polyketide cyclase/dehydrase a...		Potri.004G020000 [exp]	0	1
AT5G42810		ATIPK1	inositol-pentakisphosphate 2-k...		Potri.005G230200 [exp]	2.00	0.8849
AT1G24620			EF hand calcium-binding protei...		Potri.002G088500 [exp]	2.44	0.9054
AT2G16250			Leucine-rich repeat protein ki...		Potri.002G260100 [exp]	13.63	0.8668
AT3G18440		ATALMT9	aluminum-activated malate tran...		Potri.003G134100 [exp]	14.49	0.8583
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120100 [exp]	15.96	0.8356
AT5G28010			Polyketide cyclase/dehydrase a...		Potri.004G051500 [exp]	21.63	0.8073
AT1G73040			Mannose-binding lectin superfa...		Potri.012G140001 [exp]	25.41	0.8237
					Potri.001G093100 [exp]	26.98	0.8655
					Potri.014G030700 [exp]	27.87	0.8497
AT4G14605			Mitochondrial transcription te...		Potri.017G067600 [exp]	48.68	0.8392

Compare expression of checked genes

Potri.004G020000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.