Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28000 57 / 2e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28010 55 / 8e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 55 / 1e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70890 55 / 1e-09 MLP43 MLP-like protein 43 (.1) AT1G70850 55 / 3e-09 MLP34 MLP-like protein 34 (.1.2.3) AT2G01530 52 / 8e-09 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1) AT4G14060 51 / 2e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G01520 51 / 3e-08 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) AT1G70840 50 / 6e-08 MLP31 MLP-like protein 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G020000 [exp] 270 / 3e-94 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G051500 [exp] 112 / 1e-31 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G111000 [exp] 53 / 4e-09 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.008G131200 [exp] 50 / 5e-08 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131300 [exp] 49 / 8e-08 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.017G051200 [exp] 43 / 9e-06 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039893 [exp] 48 / 6e-08 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002176 [exp] 49 / 2e-07 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2) Lus10029184 [exp] 43 / 5e-05 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2) Lus10020497 [exp] 42 / 5e-05 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10042490 [exp] 42 / 8e-05 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039863 [exp] 41 / 8e-05 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10012466 [exp] 41 / 0.0001 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10033397 [exp] 41 / 0.0001 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042489 [exp] 41 / 0.0001 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008931 [exp] 39 / 0.0002 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.004G020100.1 pacid=42794664 polypeptide=Potri.004G020100.1.p locus=Potri.004G020100 ID=Potri.004G020100.1.v4.1 annot-version=v4.1 ATGGATTGCCTTCAAGAAAACTTCTTTGAAACACCAGTTCATTTATTTTCTGGTTTTGCTCCCCGTAGCCGAAAAGTCGTTGAAACACCAATTCAATGCT CTACTACTGCCTTTTATAAGTTCTTCAAGAAACAAGCAAACTTCTTACCGAATGTCTGCGGTTCTGTTGTGCAGACAATAGGACTTGTTGACAGTAACAA AAGCTGGGTTAATACTGTTGGCTCTCGCAAGGTGATTGAAATCCTGTCTGCCGAGTCTTGCCGTGATACTGCGGAGAAATTCAAGTATATAGTTGAAGCC ATTGACGACCGCTCCAGGAAAATCACCTACAAATTGCTGGAAGGATCGTTGCTGCAATTATATGACAACTTCACCGTCACTCTACAGGTTACTTCTGCCA GCACCGCAAAATGGACCATCGAATATCAGAAAAAAAAGCCAACCAGCGAAGACCCTGATTTTTACCTCAAACTTTTTCCTACTATCAACGCTACTGTTGA TATTTATCTTCGTTCTAATGATGACTAA
AA sequence Show only first row Show all	>Potri.004G020100.1 pacid=42794664 polypeptide=Potri.004G020100.1.p locus=Potri.004G020100 ID=Potri.004G020100.1.v4.1 annot-version=v4.1 MDCLQENFFETPVHLFSGFAPRSRKVVETPIQCSTTAFYKFFKKQANFLPNVCGSVVQTIGLVDSNKSWVNTVGSRKVIEILSAESCRDTAEKFKYIVEA IDDRSRKITYKLLEGSLLQLYDNFTVTLQVTSASTAKWTIEYQKKKPTSEDPDFYLKLFPTINATVDIYLRSNDD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70880			Polyketide cyclase/dehydrase a...		Potri.004G020100 [exp]	0	1
					Potri.014G030700 [exp]	2.00	0.9045
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Potri.007G042900 [exp]	3.74	0.8731
AT4G25970		PSD3, PSD2	phosphatidylserine decarboxyla...		Potri.002G127000 [exp]	6.48	0.8818
					Potri.001G093100 [exp]	11.31	0.8966
AT1G15530			Concanavalin A-like lectin pro...		Potri.012G084900 [exp]	13.41	0.8425
					Potri.010G007932 [exp]	13.71	0.8898
AT5G52120		ATPP2-A14	phloem protein 2-A14 (.1)		Potri.015G138600 [exp]	14.42	0.8350
AT5G24470		APRR5	pseudo-response regulator 5 (....		Potri.012G005900 [exp]	15.29	0.8789
					Potri.017G111225 [exp]	17.32	0.8959
AT5G07580	AP2_ERF		Integrase-type DNA-binding sup...		Potri.003G151000 [exp]	19.07	0.8801

Compare expression of checked genes

Potri.004G020100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.