Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11580 88 / 3e-22 ATPMEPCRA methylesterase PCR A (.1) AT3G43270 88 / 4e-22 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G53370 84 / 7e-21 ATPMEPCRF pectin methylesterase PCR fragment F (.1) AT3G60730 80 / 3e-19 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G23200 79 / 6e-19 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G33220 79 / 6e-19 PME44, ATPME44 A. THALIANA PECTIN METHYLESTERASE 44, pectin methylesterase 44 (.1) AT2G45220 77 / 4e-18 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G49220 77 / 4e-18 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G11590 76 / 5e-18 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G03930 76 / 7e-18 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G025400 [exp] 107 / 5e-29 AT1G11580 638 / 0.0 methylesterase PCR A (.1) Potri.011G135000 [exp] 97 / 3e-25 AT1G11580 560 / 0.0 methylesterase PCR A (.1) Potri.015G127500 [exp] 83 / 2e-20 AT2G45220 573 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G014500 [exp] 83 / 2e-20 AT3G49220 789 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G127700 [exp] 83 / 3e-20 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G126800 [exp] 81 / 8e-20 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.005G022800 [exp] 81 / 1e-19 AT4G02330 571 / 0.0 pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.014G067100 [exp] 80 / 2e-19 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G013700 [exp] 79 / 5e-19 AT3G49220 805 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001467 [exp] 82 / 3e-22 AT4G02320 124 / 5e-35 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10027202 [exp] 85 / 4e-21 AT2G45220 620 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10039927 [exp] 85 / 6e-21 AT2G26450 598 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10038917 [exp] 84 / 2e-20 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10006103 [exp] 82 / 3e-20 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10027656 [exp] 82 / 4e-20 AT4G33230 499 / 6e-174 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10009110 [exp] 82 / 8e-20 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10028536 [exp] 79 / 8e-20 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008203 [exp] 80 / 3e-19 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10027206 [exp] 80 / 3e-19 AT2G45220 551 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [poplar] [flax] Pec_lyase-like PF01095 [poplar] [flax] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Potri.004G020800.1 pacid=42795674 polypeptide=Potri.004G020800.1.p locus=Potri.004G020800 ID=Potri.004G020800.1.v4.1 annot-version=v4.1 ATGGTGAATCCAGCTGGGTGGTCAGTGTGGGAAGGGGAGTTTCCATCAAAGACTTTGTATTACGGTGAATACTCGAACCAGGGACCAGGTGCTGGTGCTG GTAAAAGAGTGAAGTGGCCTGGTTATCATGTCATTACTAGTGCTAACGAGGCCATGAAATTCACAGTGGCTGAGCTGATACAAGGCGGCATGGCTGAGGG TTACTGGAGTTGCTTGTAA
AA sequence Show only first row Show all	>Potri.004G020800.1 pacid=42795674 polypeptide=Potri.004G020800.1.p locus=Potri.004G020800 ID=Potri.004G020800.1.v4.1 annot-version=v4.1 MVNPAGWSVWEGEFPSKTLYYGEYSNQGPGAGAGKRVKWPGYHVITSANEAMKFTVAELIQGGMAEGYWSCL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11580		ATPMEPCRA	methylesterase PCR A (.1)		Potri.004G020800 [exp]	0	1
AT1G63320			Pentatricopeptide repeat (PPR)...		Potri.005G046050 [exp]	14.38	0.7301
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G110400 [exp]	14.79	0.8996
AT2G24940		ATMAPR2	membrane-associated progestero...		Potri.006G266200 [exp]	18.22	0.8984
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G109300 [exp]	23.21	0.8945
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G109800 [exp]	23.23	0.8951
AT1G10070		ATBCAT-2	branched-chain amino acid tran...		Potri.009G082700 [exp]	31.46	0.8923
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G110640 [exp]	33.22	0.8879
					Potri.010G219950 [exp]	33.49	0.8898
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G110700 [exp]	34.08	0.8868
AT1G62680			Pentatricopeptide repeat (PPR)...		Potri.019G099701 [exp]	36.53	0.8865

Compare expression of checked genes

Potri.004G020800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.