Potri.004G022300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G022200 178 / 3e-58 AT3G09790 42 / 8e-05 ubiquitin 8 (.1)
Potri.004G021400 46 / 9e-07 ND /
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 Ubiquitin PF14560 Ubiquitin_2 Ubiquitin-like domain
Representative CDS sequence
>Potri.004G022300.1 pacid=42796528 polypeptide=Potri.004G022300.1.p locus=Potri.004G022300 ID=Potri.004G022300.1.v4.1 annot-version=v4.1
ATGTGTTTCTTGCAGACATTGAAGGTCAAGGTTGTTATTGATGGTACAAGGTTCCCCATAGAACTTCCAAATGATGCAACTGTCCAGGACCTAAAAGAGG
CAGTCCATCGTATGTTTAATTTCTATGCTGTGGAGAACCAAGAGTTGCTTTTTAACGGGCTGTTGTTGCTAAATTACATAAAATTAGAAACTTATGAAGT
CGTTGATGATTCTGAAATTATCCTCCAAATATTTTTCACTGTTGGAATCATCGGAAAAAACCCAGACGGGCAATACCACAGGTACGAAGTGAGAGCCCAC
CGGAGTAATACTGTTCAGGACTTGAAGCTGAAGCTCCATATGTACCATGGTTTGGACATTACCAATATGAATCTCCAAATGAGGCCTGAATATTACCTGC
AAGATCGTACTTTTTTGTGGGCTAATGAAATTTCTAGCAGCACTGATATTTATATAGTTTAG
AA sequence
>Potri.004G022300.1 pacid=42796528 polypeptide=Potri.004G022300.1.p locus=Potri.004G022300 ID=Potri.004G022300.1.v4.1 annot-version=v4.1
MCFLQTLKVKVVIDGTRFPIELPNDATVQDLKEAVHRMFNFYAVENQELLFNGLLLLNYIKLETYEVVDDSEIILQIFFTVGIIGKNPDGQYHRYEVRAH
RSNTVQDLKLKLHMYHGLDITNMNLQMRPEYYLQDRTFLWANEISSSTDIYIV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G022300 0 1
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Potri.006G103900 2.00 0.9528
AT3G18010 HD WOX1 WUSCHEL related homeobox 1 (.1... Potri.010G111400 4.24 0.9516
Potri.001G459001 5.47 0.9521
AT2G46950 CYP709B2 "cytochrome P450, family 709, ... Potri.006G022200 7.74 0.9507 Pt-CYP709.2
AT3G23600 alpha/beta-Hydrolases superfam... Potri.017G048100 7.74 0.8972
AT1G75490 AP2_ERF DREB2D Integrase-type DNA-binding sup... Potri.002G029400 8.66 0.9370
AT1G37140 MCT1 MEI2 C-terminal RRM only like ... Potri.002G088200 9.48 0.9361
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.010G042400 11.61 0.9357 Pt-INO.2
AT5G53980 HD ATHB52 homeobox protein 52 (.1) Potri.011G114500 11.66 0.9147
AT1G55290 2-oxoglutarate (2OG) and Fe(II... Potri.001G007100 13.78 0.8500

Potri.004G022300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.