Potri.004G022400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05230 144 / 1e-42 Ubiquitin-like superfamily protein (.1)
AT4G03360 112 / 1e-29 Ubiquitin family protein (.1)
AT4G02950 109 / 3e-28 CRRJ Ubiquitin family protein (.1)
AT2G32350 99 / 7e-25 Ubiquitin-like superfamily protein (.1)
AT4G05260 91 / 1e-21 Ubiquitin-like superfamily protein (.1)
AT4G05250 85 / 7e-19 Ubiquitin-like superfamily protein (.1)
AT4G03370 82 / 5e-18 Ubiquitin family protein (.1)
AT4G02970 69 / 2e-13 AT7SL-1 7SL RNA1 (.1)
AT4G05240 66 / 5e-13 Ubiquitin-like superfamily protein (.1)
AT4G03350 65 / 5e-12 EVE1 ETERNALLY VEGETATIVE PHASE 1, ubiquitin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G037600 114 / 1e-30 AT2G32350 294 / 4e-101 Ubiquitin-like superfamily protein (.1)
Potri.011G026600 61 / 4e-11 AT4G05050 452 / 3e-164 ubiquitin 11 (.1.2.3.4)
Potri.006G129600 61 / 1e-10 AT5G20620 600 / 0.0 ubiquitin 4 (.1)
Potri.017G135600 61 / 1e-10 AT4G02890 597 / 0.0 Ubiquitin family protein (.1.2.3.4)
Potri.007G123300 61 / 1e-10 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6)
Potri.001G263000 61 / 1e-10 AT4G05320 752 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6)
Potri.001G418500 61 / 1e-10 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6)
Potri.017G036800 61 / 1e-10 AT4G05320 753 / 0.0 polyubiquitin 10 (.1.2.3.4.5.6)
Potri.004G021500 61 / 1e-10 AT4G02890 604 / 0.0 Ubiquitin family protein (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007641 251 / 3e-83 AT4G05230 145 / 1e-42 Ubiquitin-like superfamily protein (.1)
Lus10018369 140 / 8e-42 AT4G05230 143 / 5e-44 Ubiquitin-like superfamily protein (.1)
Lus10039679 89 / 1e-20 AT2G32350 239 / 1e-79 Ubiquitin-like superfamily protein (.1)
Lus10018370 84 / 3e-20 AT4G02970 60 / 3e-12 7SL RNA1 (.1)
Lus10018367 61 / 5e-11 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6)
Lus10034308 42 / 0.0004 AT3G02540 491 / 7e-174 RADIATION SENSITIVE23C, PUTATIVE DNA REPAIR PROTEIN RAD23-3, Rad23 UV excision repair protein family (.1.2.3)
Lus10008873 40 / 0.0005 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1)
Lus10034307 41 / 0.0008 AT3G02540 493 / 1e-173 RADIATION SENSITIVE23C, PUTATIVE DNA REPAIR PROTEIN RAD23-3, Rad23 UV excision repair protein family (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Potri.004G022400.1 pacid=42795910 polypeptide=Potri.004G022400.1.p locus=Potri.004G022400 ID=Potri.004G022400.1.v4.1 annot-version=v4.1
ATGGATGTCATTTTTGAGCCCCAAAGAGGCGGGCCATTCTCCATTGAAGTGGGTTTCTTTGATACAGTCTCGGAGATCAAAGAGAAGGTACACAAGTACC
ATGGTATACCTATAAACAAGCAAACCCTAGTTTTTCATGGCCAAGTTCTTCAAGATGATAAAGATGTAGAATATTGTGAAATCCTCCAAAACTCTCGCAT
TCAACTCCTTATAACACCTGAAACCGATCAAATACCTCAAGACAAGGTTGAACAAACCTCACACTCCAAGAAAGTTCAGCTGCGTATCAAGATTCCATCA
AACCAAACGCTTGTCCCTCTTGAAATGGATATGAGCGATACTGTGCTACATCTAAAAGAAAAGATTCGTGAGATAGAGCCAGTTCCAGTTAAAAGATTAG
TGCTACAATCGAATGGTGCGGAGTTGCAAGATCATCAGTCTTTACATGAATGTGAGTTGAAGTATAATAGTGAGATTAGCGTCAACGTAAAGCCATCACC
ATCTGGCTCAGGATCAAAAGGGGGCTCTACAGGTTTCAAGAAACTGAGGGTGATTGTTGTGACCAAGTGTGGCACTAAGAAGATTCCTGTCGAAGTGAAT
CCATCGGATAATGTTGGAGAGCTTAGAAAAGAGCTGCAAGATTTGCAACAGAAAAATCAATTCCATCTTCCACAAGAAGGGTACTTTTTCATACATAAAC
AGGATGTTATGGACGATGATCGATCGTTTCGGTGGCACCGTGTTAACCAGGGTGATACAATTGATGTCTTCAATGGAAGAGTAACCAGTGGATCTTAG
AA sequence
>Potri.004G022400.1 pacid=42795910 polypeptide=Potri.004G022400.1.p locus=Potri.004G022400 ID=Potri.004G022400.1.v4.1 annot-version=v4.1
MDVIFEPQRGGPFSIEVGFFDTVSEIKEKVHKYHGIPINKQTLVFHGQVLQDDKDVEYCEILQNSRIQLLITPETDQIPQDKVEQTSHSKKVQLRIKIPS
NQTLVPLEMDMSDTVLHLKEKIREIEPVPVKRLVLQSNGAELQDHQSLHECELKYNSEISVNVKPSPSGSGSKGGSTGFKKLRVIVVTKCGTKKIPVEVN
PSDNVGELRKELQDLQQKNQFHLPQEGYFFIHKQDVMDDDRSFRWHRVNQGDTIDVFNGRVTSGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G05230 Ubiquitin-like superfamily pro... Potri.004G022400 0 1
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.004G104101 12.00 1.0000
AT3G17060 Pectin lyase-like superfamily ... Potri.008G104800 15.74 1.0000
AT1G15460 ATBOR4 ARABIDOPSIS THALIANA REQUIRES ... Potri.006G249800 29.49 1.0000
AT2G38300 GARP myb-like HTH transcriptional r... Potri.011G067150 35.31 1.0000
AT3G61690 nucleotidyltransferases (.1) Potri.011G116501 36.12 1.0000
AT5G28780 PIF1 helicase (.1) Potri.006G157501 36.74 1.0000
AT1G02790 PGA4 polygalacturonase 4 (.1) Potri.010G011200 39.47 1.0000
AT1G68610 PCR11 PLANT CADMIUM RESISTANCE 11 (.... Potri.010G127700 40.98 1.0000
AT3G02310 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K... Potri.004G115500 41.35 1.0000
AT1G01460 ATPIPK11 Phosphatidylinositol-4-phospha... Potri.014G093300 45.60 0.9395

Potri.004G022400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.