Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65790 160 / 2e-46 ARK1 receptor kinase 1 (.1) AT4G23180 153 / 4e-44 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23150 152 / 7e-44 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23140 152 / 8e-44 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G21380 150 / 1e-42 ARK3 receptor kinase 3 (.1) AT1G65800 150 / 1e-42 ARK2 receptor kinase 2 (.1) AT4G23230 146 / 4e-42 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT4G23160 148 / 5e-42 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G21410 143 / 2e-40 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) AT4G03230 142 / 7e-40 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G024316 [exp] 298 / 5e-106 AT1G65790 159 / 4e-46 receptor kinase 1 (.1) Potri.004G023876 [exp] 301 / 2e-100 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G023700 [exp] 244 / 2e-78 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G023964 [exp] 243 / 3e-78 AT4G23180 401 / 6e-132 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024000 [exp] 241 / 2e-77 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024140 [exp] 241 / 3e-77 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G023550 [exp] 188 / 5e-57 AT4G05200 541 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.011G027501 [exp] 186 / 2e-56 AT4G23180 553 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024228 [exp] 172 / 4e-51 AT4G23180 551 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033752 [exp] 144 / 1e-42 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10038555 [exp] 139 / 1e-42 AT4G27300 183 / 4e-54 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 149 / 2e-42 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 149 / 2e-42 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007603 [exp] 147 / 1e-41 AT4G21380 942 / 0.0 receptor kinase 3 (.1) Lus10018405 [exp] 146 / 2e-41 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10007602 [exp] 144 / 2e-40 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10038552 [exp] 143 / 2e-40 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014810 [exp] 143 / 2e-40 AT4G27290 692 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018378 [exp] 132 / 4e-40 AT4G23180 180 / 1e-53 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.004G024200.1 pacid=42795878 polypeptide=Potri.004G024200.1.p locus=Potri.004G024200 ID=Potri.004G024200.1.v4.1 annot-version=v4.1 ATGGCTCCAGAGTACGCAATGGAAGGAATATTCTCAGTGAAATCGGATGTCTTCAGCTTTGGTGTTATACTTCTTGAGATCATAAGTGGGAAAAGAAGCA GTGGTTTTTACCTCACAGAGCATGGCCAGACACTCTTAGCATATGCATGGAGATTATGGATCGAAGGGAAAGCAATGGAGTTTGTGGATCCTTTGTTGGT GGAAAGAAGCCCAGCAGAAGGGATTTTGAGGTGCATGCATATTGGGCTGTTATGTGTGCAGAAGGATCCAGCAGACAGGCCCACAATGTCATTTGTGGAT TTAGCATTGGCAAGCGACCCAATAGCTCTTCCTCAACCACAGCAACCAGCCTTTTCTCTTGTTAAAATTGTTCCAGCTGACAAGTCTTCATCAACAGATC GTTCAGTGAATCAGATGACAGTCTCTAGTTTCTTACCGAGGTGA
AA sequence Show only first row Show all	>Potri.004G024200.1 pacid=42795878 polypeptide=Potri.004G024200.1.p locus=Potri.004G024200 ID=Potri.004G024200.1.v4.1 annot-version=v4.1 MAPEYAMEGIFSVKSDVFSFGVILLEIISGKRSSGFYLTEHGQTLLAYAWRLWIEGKAMEFVDPLLVERSPAEGILRCMHIGLLCVQKDPADRPTMSFVD LALASDPIALPQPQQPAFSLVKIVPADKSSSTDRSVNQMTVSSFLPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65790		ARK1	receptor kinase 1 (.1)		Potri.004G024200 [exp]	0	1
AT1G65790		ARK1	receptor kinase 1 (.1)		Potri.004G024316 [exp]	2.00	0.8909
AT1G55790			Domain of unknown function (DU...		Potri.001G438100 [exp]	3.87	0.8672
					Potri.011G125251 [exp]	6.00	0.8266
AT4G27290			S-locus lectin protein kinase ...		Potri.011G126151 [exp]	6.00	0.8119
AT1G55790			Domain of unknown function (DU...		Potri.011G141700 [exp]	7.07	0.8167
AT4G39070	CO		B-box zinc finger family prote...		Potri.009G122000 [exp]	9.16	0.8100
AT3G03300		ATDCL2, DCL2	dicer-like 2 (.1.2.3)		Potri.010G181400 [exp]	9.94	0.8059
AT5G42180		PER64	peroxidase 64, Peroxidase supe...		Potri.005G108900 [exp]	11.22	0.7691
AT4G21410		CRK29	cysteine-rich RLK (RECEPTOR-li...		Potri.004G026350 [exp]	15.19	0.7286
AT1G67265		DVL3, RTFL21	DEVIL 3, ROTUNDIFOLIA like 21 ...		Potri.004G102950 [exp]	18.49	0.7461

Compare expression of checked genes

Potri.004G024200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.