Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23180 204 / 5e-63 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23140 197 / 3e-60 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G11530 194 / 3e-59 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G23160 195 / 4e-58 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G05200 187 / 1e-56 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G11490 184 / 2e-55 CRK33 cysteine-rich RLK (RECEPTOR-like protein kinase) 33 (.1) AT4G23150 181 / 2e-54 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23230 175 / 6e-53 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT3G45860 172 / 5e-51 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT4G23300 171 / 1e-50 CRK22 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G025200 [exp] 274 / 2e-89 AT4G23180 665 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G026100 [exp] 267 / 1e-86 AT4G23180 662 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024900 [exp] 266 / 2e-86 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025900 [exp] 263 / 2e-85 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) Potri.011G028400 [exp] 224 / 1e-70 AT4G05200 709 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G024632 [exp] 202 / 1e-64 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024404 [exp] 202 / 6e-62 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024800 [exp] 198 / 1e-60 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025800 [exp] 198 / 2e-60 AT4G23180 648 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018378 [exp] 189 / 3e-62 AT4G23180 180 / 1e-53 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007632 [exp] 177 / 2e-52 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018381 [exp] 165 / 2e-51 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007633 [exp] 173 / 3e-51 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018382 [exp] 172 / 8e-51 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007603 [exp] 163 / 5e-47 AT4G21380 942 / 0.0 receptor kinase 3 (.1) Lus10007635 [exp] 160 / 7e-46 AT4G21410 385 / 6e-122 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007602 [exp] 155 / 2e-44 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10018405 [exp] 155 / 3e-44 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10015095 [exp] 152 / 1e-43 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.004G025100.1 pacid=42796635 polypeptide=Potri.004G025100.1.p locus=Potri.004G025100 ID=Potri.004G025100.1.v4.1 annot-version=v4.1 ATGTCTCCGGAGTACGCGATGCACGGACAGTACTCCGTTAAGTCAGACGTGTATAGTTTCGGTGTCTTGATACTCGAGATTATCAGTGGCAAAAAGAACA GCAGTTTCTATCAATCAGACAATGGCATGGACCTTCTAAGCTATGCATGGAAACATTGGACAAATGGGACAGCACTGGAACTAATGGATGCAAGCTTAGG ACATTCTTACTCCAGAAATGAGATCGCTAGATGCCTCCATATTGCCTTATTGTGTGTTCAAGAAGATCCAAAAAAGAGACCAACATTGACAACAATAGTT CTCATGCTCACTAGTTTCTCTGTAACGCTACCATTGCCTCGGAAGCCGGCATATTGTGTGCAAAGCAGGACCGACTCGAGCTTACCAATAATAGGGCTGG AGTCTGACCGATCTACTTCCACGTCGAAGCCTTTGTCCGTTAATGATATGTCAATCACAGAACTATATCCTCGTTAA
AA sequence Show only first row Show all	>Potri.004G025100.1 pacid=42796635 polypeptide=Potri.004G025100.1.p locus=Potri.004G025100 ID=Potri.004G025100.1.v4.1 annot-version=v4.1 MSPEYAMHGQYSVKSDVYSFGVLILEIISGKKNSSFYQSDNGMDLLSYAWKHWTNGTALELMDASLGHSYSRNEIARCLHIALLCVQEDPKKRPTLTTIV LMLTSFSVTLPLPRKPAYCVQSRTDSSLPIIGLESDRSTSTSKPLSVNDMSITELYPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G025100 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Potri.008G007866 [exp]	7.34	0.9433
AT2G28490			RmlC-like cupins superfamily p...		Potri.009G054700 [exp]	8.77	0.9297
AT4G23130		RLK6, CRK5	RECEPTOR-LIKE PROTEIN KINASE 6...		Potri.004G025900 [exp]	15.65	0.9331
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Potri.015G106900 [exp]	16.37	0.8942	Pt-LEAFY.1
AT1G03670			ankyrin repeat family protein ...		Potri.013G133800 [exp]	16.49	0.9198
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024900 [exp]	18.00	0.9390
AT3G04480			endoribonucleases (.1)		Potri.013G047400 [exp]	19.79	0.9005
AT1G26310	MADS	CAL1, AGL10, CA...	CAULIFLOWER, AGAMOUS-like 10, ...		Potri.012G100200 [exp]	22.36	0.8594
AT1G53430			Leucine-rich repeat transmembr...		Potri.010G155800 [exp]	24.73	0.8941
AT1G57790			F-box family protein (.1)		Potri.012G106750 [exp]	26.68	0.9276

Compare expression of checked genes

Potri.004G025100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.