Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54470 97 / 3e-26 CO B-box type zinc finger family protein (.1) AT4G27310 93 / 2e-24 CO B-box type zinc finger family protein (.1) AT3G21150 65 / 1e-13 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) AT3G21890 63 / 1e-13 CO B-box type zinc finger family protein (.1) AT4G15248 60 / 1e-12 CO B-box type zinc finger family protein (.1) AT3G02380 52 / 6e-09 CO ATCOL2, COL2 CONSTANS-like 2 (.1) AT5G24930 52 / 1e-08 CO COL4, ATCOL4 CONSTANS-like 4 (.1) AT5G15850 51 / 2e-08 CO COL1, ATCOL1 CONSTANS-like 1 (.1) AT2G47890 50 / 3e-08 CO COL13 B-box type zinc finger protein with CCT domain (.1.2) AT2G24790 50 / 4e-08 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G026900 [exp] 117 / 8e-35 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1) Potri.011G039700 [exp] 109 / 3e-31 AT4G27310 105 / 3e-28 B-box type zinc finger family protein (.1) Potri.004G027000 [exp] 104 / 2e-30 AT4G27310 91 / 5e-24 B-box type zinc finger family protein (.1) Potri.001G414700 [exp] 94 / 2e-24 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1) Potri.011G125400 [exp] 92 / 1e-23 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1) Potri.013G150500 [exp] 89 / 4e-23 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1) Potri.017G039400 [exp] 64 / 2e-14 AT4G15248 100 / 3e-28 B-box type zinc finger family protein (.1) Potri.007G121100 [exp] 64 / 5e-14 AT4G15248 108 / 2e-31 B-box type zinc finger family protein (.1) Potri.010G251800 [exp] 62 / 2e-12 AT3G21150 130 / 5e-37 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018513 [exp] 95 / 5e-25 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1) Lus10039727 [exp] 95 / 6e-25 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1) Lus10031593 [exp] 90 / 2e-23 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1) Lus10033751 [exp] 89 / 5e-23 AT4G27310 114 / 9e-32 B-box type zinc finger family protein (.1) Lus10015097 [exp] 72 / 2e-17 AT4G15248 94 / 5e-26 B-box type zinc finger family protein (.1) Lus10031583 [exp] 72 / 5e-17 AT3G21890 96 / 1e-26 B-box type zinc finger family protein (.1) Lus10027151 [exp] 63 / 1e-13 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1) Lus10039694 [exp] 62 / 2e-13 AT4G15248 108 / 1e-31 B-box type zinc finger family protein (.1) Lus10033380 [exp] 57 / 1e-10 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1) Lus10034830 [exp] 54 / 1e-09 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G027100.2 pacid=42794243 polypeptide=Potri.004G027100.2.p locus=Potri.004G027100 ID=Potri.004G027100.2.v4.1 annot-version=v4.1 ATGAAAAAGTGTGAGCTCTGTGATTCTTTAGCACAAATGCACTGTGAATCGGATCAAGCTATCCTGTGTTCAGCCTGTGATGCATATGTTCACAGTGCAA ATTTTCTTGCTGCAAAACATTCAAGAACGCTTCTTTGCCATGTTTGTCAATCTCACACGCCCTGGATTGGCACCGGACCCGTGTTAGGTGCTACTCTTTC GGTTTGCAACAGCTGCATAAACAACTCGAGTTGTACTGATGGAAAAGGCAGTGAGAATGATCAAATCGCCAATAATGATGATGAGATAATTGCGAACATG ATGAAAACGATGATGGTGGTTAAGACGGCGATGAAGACGATGAAGAAAATCAAGTAG
AA sequence Show only first row Show all	>Potri.004G027100.2 pacid=42794243 polypeptide=Potri.004G027100.2.p locus=Potri.004G027100 ID=Potri.004G027100.2.v4.1 annot-version=v4.1 MKKCELCDSLAQMHCESDQAILCSACDAYVHSANFLAAKHSRTLLCHVCQSHTPWIGTGPVLGATLSVCNSCINNSSCTDGKGSENDQIANNDDEIIANM MKTMMVVKTAMKTMKKIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G54470	CO		B-box type zinc finger family ...		Potri.004G027100 [exp]	0	1
AT5G24920		ATGDU5	glutamine dumper 5 (.1)		Potri.017G107100 [exp]	17.08	0.5231
AT1G03390			HXXXD-type acyl-transferase fa...		Potri.006G157100 [exp]	45.82	0.4066
					Potri.001G190450 [exp]	147.16	0.3891
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	205.45	0.3648
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	205.96	0.3648

Compare expression of checked genes

Potri.004G027100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.