Potri.004G027533 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11300 64 / 9e-14 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
AT1G11330 59 / 4e-12 S-locus lectin protein kinase family protein (.1.2)
AT1G11350 59 / 4e-12 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1)
AT1G11410 54 / 3e-10 S-locus lectin protein kinase family protein (.1)
AT4G23180 52 / 1e-09 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT1G65790 51 / 2e-09 ARK1 receptor kinase 1 (.1)
AT4G21390 51 / 3e-09 B120 S-locus lectin protein kinase family protein (.1)
AT4G23150 49 / 1e-08 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
AT4G00970 49 / 2e-08 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1)
AT4G23300 49 / 2e-08 CRK22 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G027300 131 / 2e-37 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G038800 81 / 1e-19 AT1G11330 838 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G038512 77 / 2e-19 AT1G11350 215 / 1e-65 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1)
Potri.011G038166 76 / 3e-19 AT1G11350 179 / 4e-53 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1)
Potri.011G039200 79 / 6e-19 AT1G11330 864 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G039100 77 / 2e-18 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G037800 77 / 2e-18 AT1G11330 838 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G038000 74 / 3e-17 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Potri.011G038401 73 / 5e-17 AT1G11330 826 / 0.0 S-locus lectin protein kinase family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007610 61 / 9e-13 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10007602 57 / 2e-11 AT1G65800 788 / 0.0 receptor kinase 2 (.1)
Lus10018405 57 / 3e-11 AT4G21380 952 / 0.0 receptor kinase 3 (.1)
Lus10025774 57 / 4e-11 AT3G16030 390 / 2e-123 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1)
Lus10038411 54 / 3e-10 AT1G11330 308 / 1e-98 S-locus lectin protein kinase family protein (.1.2)
Lus10007603 53 / 8e-10 AT4G21380 942 / 0.0 receptor kinase 3 (.1)
Lus10035878 52 / 1e-09 AT3G16080 166 / 1e-53 Zinc-binding ribosomal protein family protein (.1)
Lus10025784 52 / 2e-09 AT3G16030 596 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1)
Lus10003156 52 / 2e-09 AT3G16030 556 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1)
Lus10023391 51 / 3e-09 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
PFAM info
Representative CDS sequence
>Potri.004G027533.1 pacid=42794012 polypeptide=Potri.004G027533.1.p locus=Potri.004G027533 ID=Potri.004G027533.1.v4.1 annot-version=v4.1
ATGCATGTAGGTCTTTTGTGTGTTCAAGAGTTTGCAAAAGATAGGCCAGCTGTGCCTACAATCACTTCAATGCTTCACAGCGAAATTGTGGATCTTCCTG
CTCCCAAGAAACCTGCACTTGGTTTCGAAATGGACTCCCTTCAATGGAGCCAAACGATATGTTCTAATGACATATCATTTACTGTTATTGGAGGGCGATA
G
AA sequence
>Potri.004G027533.1 pacid=42794012 polypeptide=Potri.004G027533.1.p locus=Potri.004G027533 ID=Potri.004G027533.1.v4.1 annot-version=v4.1
MHVGLLCVQEFAKDRPAVPTITSMLHSEIVDLPAPKKPALGFEMDSLQWSQTICSNDISFTVIGGR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G11300 protein serine/threonine kinas... Potri.004G027533 0 1
AT4G31970 CYP82C2, JAH1 "cytochrome P450, family 82, s... Potri.009G108832 3.16 0.9202
AT5G49890 ATCLC-C, CLC-C chloride channel C (.1) Potri.018G138100 3.46 0.9072
AT1G11330 S-locus lectin protein kinase ... Potri.004G027666 3.46 0.9241
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.009G108600 3.74 0.9174
Potri.006G028101 4.00 0.9148
AT4G19160 unknown protein Potri.001G193400 4.47 0.9104
AT5G39040 AtALS1, ABCB27,... ARABIDOPSIS THALIANA TRANSPORT... Potri.018G051800 5.38 0.9259
AT3G10870 ATMES17, MES17 ARABIDOPSIS THALIANA METHYL ES... Potri.019G131100 6.16 0.9250
AT5G56550 ATOXS3 oxidative stress 3 (.1) Potri.001G190700 15.49 0.8912
AT4G21120 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTE... Potri.015G133100 16.00 0.9026 AAT1.2,PtrCAT12

Potri.004G027533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.