Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23140 137 / 7e-39 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23160 132 / 8e-37 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23150 128 / 1e-35 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G05200 125 / 1e-34 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G23230 124 / 2e-34 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT1G11340 123 / 9e-34 S-locus lectin protein kinase family protein (.1) AT4G23180 122 / 1e-33 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G03230 122 / 2e-33 S-locus lectin protein kinase family protein (.1) AT4G27300 120 / 1e-32 S-locus lectin protein kinase family protein (.1) AT1G11410 119 / 2e-32 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G028532 [exp] 194 / 2e-64 AT4G23140 205 / 9e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.004G028400 [exp] 191 / 1e-63 AT4G23140 206 / 3e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.011G035850 [exp] 134 / 5e-39 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.011G036100 [exp] 134 / 2e-37 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036466 [exp] 129 / 4e-37 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 132 / 5e-37 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028300 [exp] 132 / 6e-37 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G414000 [exp] 132 / 9e-37 AT4G27290 766 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 132 / 1e-36 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007610 [exp] 130 / 3e-36 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10041679 [exp] 127 / 1e-35 AT1G11340 417 / 1e-137 S-locus lectin protein kinase family protein (.1) Lus10024064 [exp] 128 / 3e-35 AT1G11340 735 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10041680 [exp] 127 / 4e-35 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10014812 [exp] 127 / 7e-35 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014811 [exp] 126 / 1e-34 AT4G27290 808 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038553 [exp] 126 / 1e-34 AT4G27290 899 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007611 [exp] 125 / 2e-34 AT1G11340 751 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10034971 [exp] 120 / 2e-34 AT4G23180 269 / 5e-86 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10006745 [exp] 125 / 3e-34 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.004G028350.2 pacid=42794303 polypeptide=Potri.004G028350.2.p locus=Potri.004G028350 ID=Potri.004G028350.2.v4.1 annot-version=v4.1 ATGAACCCAAAAATTTCAGATTTCGGTATGGCAAGAATGTTTATGGAAGACCAAGTCCAAGGAAAAACCACTCGTGTGGTCGGAACATACGGCTACATGT CACCTGAGTACGCAATTCACGGACAGTATTCGATAAAGTCAGATGTCTTCAGCTATGGAGTCTTAACACTGGAGATCATAAGTGGCAGGAAAAATAGCGA CTACGGTGAGAAAGAACCCTGGCTGAATCTTATCGGACATGTATGGGACTTATGGAGAGAAGAAAAGGCATTACCATCTAAATTATATATTTACACATGG TTTTTTTTTTTTGTTTTGAAGAGGAGAAATTTTCTATGTGTTGTGTTTTATTTTTTTATCTGCTTCCTACGCTGA
AA sequence Show only first row Show all	>Potri.004G028350.2 pacid=42794303 polypeptide=Potri.004G028350.2.p locus=Potri.004G028350 ID=Potri.004G028350.2.v4.1 annot-version=v4.1 MNPKISDFGMARMFMEDQVQGKTTRVVGTYGYMSPEYAIHGQYSIKSDVFSYGVLTLEIISGRKNSDYGEKEPWLNLIGHVWDLWREEKALPSKLYIYTW FFFFVLKRRNFLCVVFYFFICFLR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028350 [exp]	0	1
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Potri.001G312650 [exp]	1.00	0.8296
AT5G26805			unknown protein		Potri.005G012700 [exp]	1.41	0.7905
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Potri.005G118500 [exp]	7.21	0.7110
AT3G04890			Uncharacterized conserved prot...		Potri.013G037050 [exp]	25.57	0.7304
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Potri.005G255900 [exp]	31.62	0.7364
AT2G32235			unknown protein		Potri.004G028100 [exp]	35.74	0.7147
					Potri.014G018801 [exp]	44.76	0.7116
AT2G15530			RING/U-box superfamily protein...		Potri.005G055667 [exp]	90.00	0.6611
					Potri.003G163151 [exp]	108.74	0.6815
					Potri.018G003201 [exp]	121.44	0.6704

Compare expression of checked genes

Potri.004G028350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.