Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23140 205 / 6e-63 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23150 200 / 5e-61 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G03230 202 / 1e-60 S-locus lectin protein kinase family protein (.1) AT4G23180 197 / 1e-59 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT1G65790 197 / 3e-59 ARK1 receptor kinase 1 (.1) AT1G65800 197 / 6e-59 ARK2 receptor kinase 2 (.1) AT1G11340 196 / 1e-58 S-locus lectin protein kinase family protein (.1) AT4G23160 195 / 5e-58 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT1G11410 192 / 4e-57 S-locus lectin protein kinase family protein (.1) AT4G23240 183 / 4e-57 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G028532 [exp] 373 / 3e-134 AT4G23140 205 / 9e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.011G035850 [exp] 228 / 1e-74 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.011G036100 [exp] 228 / 8e-71 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028701 [exp] 226 / 1e-69 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036600 [exp] 225 / 1e-69 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036466 [exp] 216 / 1e-69 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 224 / 8e-69 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028466 [exp] 223 / 9e-69 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 223 / 2e-68 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041679 [exp] 211 / 3e-66 AT1G11340 417 / 1e-137 S-locus lectin protein kinase family protein (.1) Lus10024064 [exp] 213 / 1e-64 AT1G11340 735 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006745 [exp] 211 / 1e-64 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 206 / 3e-62 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033752 [exp] 195 / 1e-61 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10020052 [exp] 203 / 3e-61 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10041680 [exp] 202 / 3e-60 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10007611 [exp] 200 / 4e-60 AT1G11340 751 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006746 [exp] 198 / 2e-59 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10005137 [exp] 184 / 3e-59 AT1G11340 225 / 1e-68 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase CL0016 [poplar] [flax] PF11883 [poplar] [flax] DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence Show only first row Show all	>Potri.004G028400.3 pacid=42794433 polypeptide=Potri.004G028400.3.p locus=Potri.004G028400 ID=Potri.004G028400.3.v4.1 annot-version=v4.1 ATGAACCCAAAAATTTCAGATTTCGGTATGGCAAGAAAGTTTATGGAAGACCAAGTCCAAGGAAAAACCACTCGTGTGGTCGGAACATATGGCTACATGT CACCTGAGTACGCAATTCACGGACAGTATTCGATAAAGTCAGATGTCTTCAGCTATGGTGTCTTAACACTGGAGATCATAAGTGGCAGGAAAAATAGCGA CTACGGTGAGAAAGAACCCTGGCTGAATCTTATCGGACATGTATGGGACTTATGGAGAGAAGAAAAGGCATTAGACATAGTTGATCCAATGCTGGAACAG GCATGCCCTCCTCATGAAGTTTTGAGATGCGTTCAGATTGGGTTACTGTGTGTGCAAGAATTTCCAGATGATCGACCTGCAATGTTAGAAGTTGTGTTCA TGTTAGGTAATGAGATAACTCTTCCTTCCCCTAAGAAGCCAGCATTTGTTTTACGAACACGCAGTGGACAAGACTTGCCAGCAATGTCTAGACGAGCAGC TTGTTCTGTAAATGAAGTTACAGTTACTATGGTGGAAGCTCGCTGA
AA sequence Show only first row Show all	>Potri.004G028400.3 pacid=42794433 polypeptide=Potri.004G028400.3.p locus=Potri.004G028400 ID=Potri.004G028400.3.v4.1 annot-version=v4.1 MNPKISDFGMARKFMEDQVQGKTTRVVGTYGYMSPEYAIHGQYSIKSDVFSYGVLTLEIISGRKNSDYGEKEPWLNLIGHVWDLWREEKALDIVDPMLEQ ACPPHEVLRCVQIGLLCVQEFPDDRPAMLEVVFMLGNEITLPSPKKPAFVLRTRSGQDLPAMSRRAACSVNEVTVTMVEAR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028400 [exp]	0	1
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028532 [exp]	1.00	0.9882
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.008G189400 [exp]	2.44	0.9650
					Potri.018G137700 [exp]	3.00	0.9628
AT5G53590			SAUR-like auxin-responsive pro...		Potri.001G306300 [exp]	3.46	0.9441
					Potri.006G162650 [exp]	4.47	0.9447
					Potri.005G063600 [exp]	9.79	0.9589
AT1G49010	MYB		Duplicated homeodomain-like su...		Potri.012G060300 [exp]	10.19	0.9422
AT4G08570			Heavy metal transport/detoxifi...		Potri.005G003700 [exp]	11.22	0.9394
AT4G24050			NAD(P)-binding Rossmann-fold s...		Potri.003G144100 [exp]	16.24	0.8912
AT5G51545		LPA2	low psii accumulation2 (.1)		Potri.015G129600 [exp]	16.94	0.9431

Compare expression of checked genes

Potri.004G028400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.