Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09280 43 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G125100 [exp] 44 / 8e-07 ND / Potri.013G152300 [exp] 40 / 2e-05 ND / Potri.006G092200 [exp] 40 / 5e-05 AT3G09280 40 / 7e-05 unknown protein Potri.016G103700 [exp] 37 / 0.0007 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021099 [exp] 47 / 9e-08 AT3G09280 67 / 4e-15 unknown protein Lus10017211 [exp] 39 / 7e-05 AT3G09280 69 / 6e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G029700.1 pacid=42796047 polypeptide=Potri.004G029700.1.p locus=Potri.004G029700 ID=Potri.004G029700.1.v4.1 annot-version=v4.1 ATGGCTAGGCTTCTTCTCCTTAGCATTGTGCTGGCTGATCTGTCGGTGTTAGGATTACCGCAGCCACCTGCTCCAAGTCCAGCACCATCTGAAGGTGGGG TAGTAATCCCTGCTAGTCCCTGGATCAGGCGGATAGCAAGACATCATTCTGATAAGTCTGAAGCTGGGGGAGATGTGATTCTTGGTGGATTCTTGGTAGC CATTGTTGCAGTGGTTTTGTGTTACATTCGTGTCACGAGACGAAACCAAATCCAGGATGCCTGA
AA sequence Show only first row Show all	>Potri.004G029700.1 pacid=42796047 polypeptide=Potri.004G029700.1.p locus=Potri.004G029700 ID=Potri.004G029700.1.v4.1 annot-version=v4.1 MARLLLLSIVLADLSVLGLPQPPAPSPAPSEGGVVIPASPWIRRIARHHSDKSEAGGDVILGGFLVAIVAVVLCYIRVTRRNQIQDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09280			unknown protein		Potri.004G029700 [exp]	0	1
AT4G01810			Sec23/Sec24 protein transport ...		Potri.014G112600 [exp]	7.34	0.7594
AT3G54070			Ankyrin repeat family protein ...		Potri.014G058100 [exp]	12.72	0.7641
AT5G38560		AtPERK8	proline-rich extensin-like rec...		Potri.017G110400 [exp]	16.52	0.7616
AT1G13170		ORP1D	OSBP(oxysterol binding protein...		Potri.008G182766 [exp]	17.26	0.7759
AT5G06740			Concanavalin A-like lectin pro...		Potri.018G028800 [exp]	18.49	0.7391
AT4G18840			Pentatricopeptide repeat (PPR-...		Potri.001G108500 [exp]	26.90	0.7616
AT5G58290		RPT3	regulatory particle triple-A A...		Potri.006G029100 [exp]	34.59	0.7238
AT4G03390		SRF3	STRUBBELIG-receptor family 3 (...		Potri.019G103900 [exp]	41.56	0.7401
AT1G27170			transmembrane receptors;ATP bi...		Potri.019G070522 [exp]	44.15	0.7136
AT5G61910			DCD (Development and Cell Deat...		Potri.015G106400 [exp]	47.90	0.7280	Pt-BON1.2

Compare expression of checked genes

Potri.004G029700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.