Potri.004G030600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22104 313 / 9e-101 Phototropic-responsive NPH3 family protein (.1)
AT3G19850 211 / 2e-61 Phototropic-responsive NPH3 family protein (.1)
AT1G50280 183 / 4e-51 Phototropic-responsive NPH3 family protein (.1)
AT3G08660 164 / 5e-44 Phototropic-responsive NPH3 family protein (.1)
AT5G48800 160 / 2e-42 Phototropic-responsive NPH3 family protein (.1)
AT3G50840 159 / 4e-42 Phototropic-responsive NPH3 family protein (.1)
AT5G03250 154 / 2e-40 Phototropic-responsive NPH3 family protein (.1)
AT1G30440 152 / 3e-39 Phototropic-responsive NPH3 family protein (.1)
AT3G08570 150 / 9e-39 Phototropic-responsive NPH3 family protein (.1)
AT2G47860 148 / 4e-38 SETH6 Phototropic-responsive NPH3 family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G032100 776 / 0 AT3G22104 309 / 4e-99 Phototropic-responsive NPH3 family protein (.1)
Potri.007G118800 466 / 5e-160 AT3G22104 505 / 1e-175 Phototropic-responsive NPH3 family protein (.1)
Potri.017G041600 451 / 5e-154 AT3G22104 488 / 4e-169 Phototropic-responsive NPH3 family protein (.1)
Potri.008G085500 265 / 3e-81 AT3G19850 449 / 2e-152 Phototropic-responsive NPH3 family protein (.1)
Potri.010G170900 261 / 6e-80 AT3G19850 426 / 2e-143 Phototropic-responsive NPH3 family protein (.1)
Potri.016G090400 167 / 5e-45 AT5G03250 768 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.002G242300 155 / 9e-41 AT5G48800 899 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.007G112600 155 / 2e-40 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.001G357100 154 / 3e-40 AT1G30440 971 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039710 372 / 2e-123 AT3G22104 433 / 9e-148 Phototropic-responsive NPH3 family protein (.1)
Lus10018499 359 / 2e-118 AT3G22104 420 / 2e-142 Phototropic-responsive NPH3 family protein (.1)
Lus10034200 177 / 1e-48 AT3G19850 390 / 1e-129 Phototropic-responsive NPH3 family protein (.1)
Lus10030554 168 / 5e-45 AT3G19850 414 / 5e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10012901 167 / 7e-45 AT3G19850 415 / 3e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10023274 160 / 2e-42 AT1G30440 910 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10025928 158 / 1e-41 AT5G48800 925 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10013799 156 / 7e-41 AT5G03250 672 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 153 / 8e-40 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10026511 152 / 2e-39 AT5G03250 665 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Potri.004G030600.1 pacid=42796309 polypeptide=Potri.004G030600.1.p locus=Potri.004G030600 ID=Potri.004G030600.1.v4.1 annot-version=v4.1
ATGGAAGTTTGCTACATTCTTGAAGTTGATGTCAATGGAGAAGAAATTTTCATAGTGGACAAGAAAACTCTTTCATCCTTCTCAGATAGGCTCAGCAAAT
TATTTGGTGATTTGACTGATGGTTCAAGAAAATTGAAAGTAATATTTGACAACTTTCCAGGAGGTGCATATGGTTTCGAGCTCATGGCAAGGTTTTGCTA
CAACAATGGCACCATTGAGATAACTCCTTCTAACATTGTGCTGCTAAACCATGCTGCTCATTACATGGAGATGGGCAGTAATAGCTCAGCAAAGCTTAAT
CTAGTAGATCAGACTGAGAAATTTCTTGAAGGGATCAACTACTGGACTTGGTCTGACCTCCTGCAAGCCCTTAAACTGTGCCAAGATTTACTTCCTACTA
TAAATTCTTCATTTTTGCTTGATAAAGTCTTGGATTGCCTTGTAGGGAGGCTTACTTTGCCAACTATGGCAAGCCCATTTACATGTTCTTCAAACAATTC
CAGTTTTCAGTTCTCATGTGATACAAGCAGCACCTGTAGTATGAGAAACAACTGGTCTCAAACAACTTGGTGGTTTGAAGATCTTTTGGTTTTGAATGTT
AATTCATTTGACAAAGTAATCAGGATGATGATGTCCCAGAAACTAGATCATGCTGCCATTTTTAAGTTCATCGTTTTTCGCCTAAAATCGAGATATTTCA
GTGTCACGGCATCTGAGAAGTGCAAAATCACAGAGGTTGCAATCAATCTGCTTTCACTGCTTGATAGGAGCTCTCTTTCTTGCAGAGGCTTATTTGATAT
TCTACTAGCAGTCTCAAGGTTGAAAAATATAAGCAAGTTTTACGCACTCAAGCTAGAGCATCTGGTTGGTTCAATGCTAGATCAAGCAACTTTGGATCAT
CTACTTGTTCCATCTCCACACAGGAACCATCATGTGTATGATGTGAATTTAGTTTTGAGGCTTTTAAAAGCATTTTTCCTTGAAGGTTCAACGATGTCTC
GAAATCAATTGAAGAAGGTTGCTAGCTTGATGGATTCGTACCTTATAGAAGTAGCCCCAGATATCCTTCTGAAACCTTCCAAGTTTGCAGCATTGATAAT
GGTTTTGCCAGATTCTGCTAGAGAATTCAGTGACAGACTCTATCACGCTATTGACATGTATCTCCAGGTCCATGTTCAATTATGTGAAGAGGTAAAGATG
AGACTATGTTCTTTTGTCAACCATGATAAGCTCTCGGCAGAAGCTTCCAAACACCTTGCTCGAAACTCAAACTTTCCAACAAGATCAACACTCAAAAGTT
TCATTACTCAGAAATCCAAGCTCAATTGCTTAATCCATAATCGCTTATCTCATTTCGAAGTCTCAAGCCAATTGAAGTTTCATAGCAATGCCATGGAAGA
ACAAGAGGGCTTTGATCAAATCCTTATTTATGCTAGAAAGCATGGACATTCAAAGGAGATTGACAATCTTGAAACCAGATTGCAAGGAATGCAGAAAAAG
GTGACAGAATTGGAGAAAGTTTGTACAATGATGCATTCGGAGATGTCAAGTGTGACAAAATCAAGATTGCATGGCCCTGGAAAGGCTAGATCATTGCCGA
AACTTTGTTCATGA
AA sequence
>Potri.004G030600.1 pacid=42796309 polypeptide=Potri.004G030600.1.p locus=Potri.004G030600 ID=Potri.004G030600.1.v4.1 annot-version=v4.1
MEVCYILEVDVNGEEIFIVDKKTLSSFSDRLSKLFGDLTDGSRKLKVIFDNFPGGAYGFELMARFCYNNGTIEITPSNIVLLNHAAHYMEMGSNSSAKLN
LVDQTEKFLEGINYWTWSDLLQALKLCQDLLPTINSSFLLDKVLDCLVGRLTLPTMASPFTCSSNNSSFQFSCDTSSTCSMRNNWSQTTWWFEDLLVLNV
NSFDKVIRMMMSQKLDHAAIFKFIVFRLKSRYFSVTASEKCKITEVAINLLSLLDRSSLSCRGLFDILLAVSRLKNISKFYALKLEHLVGSMLDQATLDH
LLVPSPHRNHHVYDVNLVLRLLKAFFLEGSTMSRNQLKKVASLMDSYLIEVAPDILLKPSKFAALIMVLPDSAREFSDRLYHAIDMYLQVHVQLCEEVKM
RLCSFVNHDKLSAEASKHLARNSNFPTRSTLKSFITQKSKLNCLIHNRLSHFEVSSQLKFHSNAMEEQEGFDQILIYARKHGHSKEIDNLETRLQGMQKK
VTELEKVCTMMHSEMSSVTKSRLHGPGKARSLPKLCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22104 Phototropic-responsive NPH3 fa... Potri.004G030600 0 1
AT1G76770 HSP20-like chaperones superfam... Potri.005G192700 5.19 0.8845
AT1G78940 Protein kinase protein with ad... Potri.007G001900 9.27 0.8073
AT2G23360 Plant protein of unknown funct... Potri.009G099500 9.79 0.8146
AT1G21740 Protein of unknown function (D... Potri.004G177200 10.67 0.8527
AT3G60320 Protein of unknown function (D... Potri.014G047400 10.90 0.8334
AT3G54220 GRAS SGR1, SCR SHOOT GRAVITROPISM 1, SCARECRO... Potri.006G114200 15.23 0.8739
AT2G46410 MYB CPC CAPRICE, Homeodomain-like supe... Potri.004G015100 16.15 0.8640
AT3G47800 Galactose mutarotase-like supe... Potri.004G129700 16.24 0.8302
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Potri.015G066000 20.39 0.8278 HA2.2
AT3G26932 DRB3 dsRNA-binding protein 3 (.1.2) Potri.001G325300 20.97 0.8325

Potri.004G030600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.