Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrcCXXS1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11530 179 / 1e-59 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT3G56420 99 / 1e-27 Thioredoxin superfamily protein (.1) AT3G51030 92 / 5e-25 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT2G40790 92 / 8e-25 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G08710 89 / 1e-23 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT1G45145 86 / 8e-23 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G39950 83 / 2e-21 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 83 / 2e-21 ATH7 thioredoxin H-type 7 (.1) AT1G19730 82 / 5e-21 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G42980 81 / 7e-21 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G416500 [exp] 188 / 5e-63 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.011G031100 [exp] 119 / 1e-35 AT1G11530 94 / 9e-26 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 101 / 2e-28 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 96 / 2e-26 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 94 / 2e-25 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 90 / 4e-24 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 89 / 4e-24 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 86 / 1e-22 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.017G076700 [exp] 85 / 4e-22 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018383 [exp] 169 / 4e-55 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10007630 [exp] 167 / 9e-55 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10020070 [exp] 163 / 5e-53 AT1G11530 145 / 4e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10022727 [exp] 100 / 7e-28 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 99 / 1e-27 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014277 [exp] 87 / 4e-23 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 87 / 7e-23 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 86 / 1e-22 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 85 / 3e-22 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 84 / 6e-22 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.004G031700.1 pacid=42796436 polypeptide=Potri.004G031700.1.p locus=Potri.004G031700 ID=Potri.004G031700.1.v4.1 annot-version=v4.1 ATGGAGAGCCAAGAACAGCAACCTAAGTCAAGAGTTATAAAGGTGGAGTCAGTGGAGTCATGGGATTTCTATATCACCCAAGCCACCAATCAAGCCTGCC CTATCGTTGTTCACTTCACAGCTTTATGGTGTATGCCATCAGTGGCCATGAACCCAGTTTTTGAAGAACTGGCCTCAGCTTATCCAGATGGCCTGTTTCT CATTGTTGATGTGGATGAGGTTAAGGAGGTAGCTACCAAGATGGAGGTGAAGGCCATGCCGACATTTGTGCTGATGAAGGATGGTGCCCAAGTTGACAAG ATAGTTGGTGCAAATCCAGAAGAGATAAGGAAAAGGATTGATGGTTTTGTGCAGTCCATTCGTGCGTATAATGCATAG
AA sequence Show only first row Show all	>Potri.004G031700.1 pacid=42796436 polypeptide=Potri.004G031700.1.p locus=Potri.004G031700 ID=Potri.004G031700.1.v4.1 annot-version=v4.1 MESQEQQPKSRVIKVESVESWDFYITQATNQACPIVVHFTALWCMPSVAMNPVFEELASAYPDGLFLIVDVDEVKEVATKMEVKAMPTFVLMKDGAQVDK IVGANPEEIRKRIDGFVQSIRAYNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Potri.004G031700 [exp]	0	1	PtrcCXXS1
AT5G01750			Protein of unknown function (D...		Potri.016G131500 [exp]	11.04	0.8958
AT5G01750			Protein of unknown function (D...		Potri.016G130800 [exp]	11.83	0.8784
AT5G25880		ATNADP-ME3	Arabidopsis thaliana NADP-mali...		Potri.018G046600 [exp]	16.24	0.8227
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.011G165700 [exp]	19.33	0.8383
AT4G27190			NB-ARC domain-containing disea...		Potri.001G444000 [exp]	21.02	0.8532
AT1G58400			Disease resistance protein (CC...		Potri.010G044601 [exp]	21.77	0.8829
AT5G01750			Protein of unknown function (D...		Potri.016G131300 [exp]	25.39	0.8183
AT5G22355			Cysteine/Histidine-rich C1 dom...		Potri.016G044800 [exp]	31.28	0.8597
AT3G14470			NB-ARC domain-containing disea...		Potri.012G122200 [exp]	34.05	0.8643
AT5G01750			Protein of unknown function (D...		Potri.016G131850 [exp]	34.75	0.7866

Compare expression of checked genes

Potri.004G031700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.