Potri.004G032900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24020 59 / 2e-11 MLP423 MLP-like protein 423 (.1.2)
AT5G28010 54 / 3e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 53 / 4e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70850 54 / 8e-09 MLP34 MLP-like protein 34 (.1.2.3)
AT1G14960 51 / 2e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70840 50 / 5e-08 MLP31 MLP-like protein 31 (.1)
AT1G70830 48 / 3e-07 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70890 47 / 5e-07 MLP43 MLP-like protein 43 (.1)
AT1G14930 46 / 1e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G26460 45 / 2e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G033000 323 / 2e-115 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2)
Potri.008G212100 118 / 2e-34 AT1G24020 50 / 6e-08 MLP-like protein 423 (.1.2)
Potri.010G000600 111 / 9e-32 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
Potri.010G000400 108 / 2e-30 AT1G24020 66 / 4e-14 MLP-like protein 423 (.1.2)
Potri.010G000200 107 / 4e-30 AT1G24020 65 / 1e-13 MLP-like protein 423 (.1.2)
Potri.008G212700 86 / 1e-21 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G213446 86 / 1e-21 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G213669 86 / 1e-21 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.004G021100 82 / 3e-20 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016840 105 / 2e-29 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10037715 97 / 5e-26 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10016839 79 / 8e-19 ND /
Lus10014508 76 / 1e-17 ND /
Lus10015339 71 / 6e-16 ND 41 / 6e-05
Lus10030840 70 / 2e-15 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10032178 69 / 4e-15 ND /
Lus10030646 69 / 5e-15 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
Lus10039454 66 / 8e-14 AT1G24020 43 / 1e-05 MLP-like protein 423 (.1.2)
Lus10005608 63 / 1e-12 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.004G032900.1 pacid=42796681 polypeptide=Potri.004G032900.1.p locus=Potri.004G032900 ID=Potri.004G032900.1.v4.1 annot-version=v4.1
ATGGTTTCTGGAACCATTTTGGCAGAGCACACCTCTGCAGTCCCAGCAGATAGGCTATGGAAAGCATCATTCTGTGATGGCCATAACCTCATCCCTAAAC
TTCTGCCCGGAATCATCTCAAGCATTGATATACTTGAAGGAGATGGTGCTGCGGTTGGCTCCGTCAAGAAGTTCAACTTCACCGATGTTATCAAGGACTA
TAGCTATGTCAAGGATCGTGTGGAGGTGATGGACCAAGAGAATCACATAGTCAAGTATTCTACCCTTGAAGGCGGTGTTATTGGTGTCAAAGTGAAGTCC
TACAGTGTTGAGATTAGTTTGACATCAACCAGTGAAGGAGGATGCTTGTCCAAGATGAAGATTGAATATGAATCAATCGGGGACAGCTTACTATCCGAGG
AAGATGCCAATGATATGCAGCAAGGAATCTTTGCTATGGTGAAGGCTATTGATGCTCACCTGGTGGAAAACCCTACTGCTTATGCGTGA
AA sequence
>Potri.004G032900.1 pacid=42796681 polypeptide=Potri.004G032900.1.p locus=Potri.004G032900 ID=Potri.004G032900.1.v4.1 annot-version=v4.1
MVSGTILAEHTSAVPADRLWKASFCDGHNLIPKLLPGIISSIDILEGDGAAVGSVKKFNFTDVIKDYSYVKDRVEVMDQENHIVKYSTLEGGVIGVKVKS
YSVEISLTSTSEGGCLSKMKIEYESIGDSLLSEEDANDMQQGIFAMVKAIDAHLVENPTAYA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.004G032900 0 1
AT3G02630 Plant stearoyl-acyl-carrier-pr... Potri.010G179500 1.41 0.9824
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.004G033000 2.64 0.9826
AT3G01190 Peroxidase superfamily protein... Potri.004G023100 2.82 0.9766
AT1G30760 FAD-binding Berberine family p... Potri.001G463400 3.00 0.9806
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Potri.013G092400 4.47 0.9753 NAC064
AT5G37970 S-adenosyl-L-methionine-depend... Potri.017G122000 6.92 0.9733
AT5G17540 HXXXD-type acyl-transferase fa... Potri.001G447300 7.93 0.9723
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Potri.012G042800 8.48 0.9753
AT3G01190 Peroxidase superfamily protein... Potri.004G023200 8.77 0.9686
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.001G002800 11.22 0.9620 CYP716D1

Potri.004G032900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.