Potri.004G033000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24020 57 / 1e-10 MLP423 MLP-like protein 423 (.1.2)
AT1G70850 52 / 2e-08 MLP34 MLP-like protein 34 (.1.2.3)
AT5G28010 51 / 3e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G14960 50 / 6e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70840 48 / 2e-07 MLP31 MLP-like protein 31 (.1)
AT1G70890 46 / 1e-06 MLP43 MLP-like protein 43 (.1)
AT1G70830 45 / 2e-06 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G14930 44 / 9e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT3G26460 43 / 1e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G032900 323 / 2e-115 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2)
Potri.008G212100 119 / 1e-34 AT1G24020 50 / 6e-08 MLP-like protein 423 (.1.2)
Potri.010G000600 112 / 4e-32 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
Potri.010G000400 108 / 2e-30 AT1G24020 66 / 4e-14 MLP-like protein 423 (.1.2)
Potri.010G000200 107 / 5e-30 AT1G24020 65 / 1e-13 MLP-like protein 423 (.1.2)
Potri.008G212700 86 / 6e-22 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G213446 86 / 6e-22 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.008G213669 86 / 6e-22 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2)
Potri.004G021100 86 / 9e-22 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016840 107 / 4e-30 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2)
Lus10037715 99 / 9e-27 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Lus10016839 81 / 1e-19 ND /
Lus10014508 79 / 4e-19 ND /
Lus10032178 73 / 1e-16 ND /
Lus10015339 72 / 2e-16 ND 41 / 6e-05
Lus10030840 69 / 3e-15 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10030646 69 / 6e-15 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
Lus10039454 67 / 2e-14 AT1G24020 43 / 1e-05 MLP-like protein 423 (.1.2)
Lus10005608 63 / 6e-13 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Potri.004G033000.1 pacid=42796636 polypeptide=Potri.004G033000.1.p locus=Potri.004G033000 ID=Potri.004G033000.1.v4.1 annot-version=v4.1
ATGGTTTCTGGAACCATTTTGGCAGAGTACACCTCTGCAGTCCCAGCAGATAGGCTATGGAAAGCATCATTCTGTGATGGCCATAACCTCATCCCTAAAC
TTCTGCCCGGAATCATCTCAAGCATTGATATACTTGAAGGAGATGGTGCCGGGGTTGGATCCGTCAAGAAGTTCAACTTCACCGATGTTATCAAGGACTA
TAGCTATGTCAAGGATCGTGTGGAGGTGATGGACCAAGAGAATCACATAGTCAGGTATTCTACCCTTGAAGGCGGTGTTATTGGTGTCAAAGTGAAGTCC
TACAGTGTTGAGGTTAGTTTGACATCAACCAATGAAGGAGGATGCTTGTCCAAGATGAAGATTGAATATGAATCAATCGGGGACAGCTTACTATCCGAGG
AAGATGCCAATGATATGCAGCAAGGAATCTTTGCTATGGTGAAGGCTGTTGATGCTCACCTGGTGGAAAACCCTACTGCTTATGCGTGA
AA sequence
>Potri.004G033000.1 pacid=42796636 polypeptide=Potri.004G033000.1.p locus=Potri.004G033000 ID=Potri.004G033000.1.v4.1 annot-version=v4.1
MVSGTILAEYTSAVPADRLWKASFCDGHNLIPKLLPGIISSIDILEGDGAGVGSVKKFNFTDVIKDYSYVKDRVEVMDQENHIVRYSTLEGGVIGVKVKS
YSVEVSLTSTNEGGCLSKMKIEYESIGDSLLSEEDANDMQQGIFAMVKAVDAHLVENPTAYA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.004G033000 0 1
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Potri.012G042800 1.00 0.9952
AT4G00750 S-adenosyl-L-methionine-depend... Potri.012G137300 1.41 0.9908
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.004G032900 2.64 0.9826
AT1G66120 AMP-dependent synthetase and l... Potri.016G034800 2.82 0.9853
AT2G01900 DNAse I-like superfamily prote... Potri.008G139600 3.00 0.9880
AT5G37990 S-adenosyl-L-methionine-depend... Potri.017G121800 3.87 0.9830
AT1G12740 CYP87A2 "cytochrome P450, family 87, s... Potri.003G122500 5.47 0.9830 CYP87.2
AT5G17540 HXXXD-type acyl-transferase fa... Potri.001G447300 5.74 0.9770
AT3G01190 Peroxidase superfamily protein... Potri.004G023100 6.24 0.9755
AT5G37970 S-adenosyl-L-methionine-depend... Potri.017G122000 6.32 0.9779

Potri.004G033000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.