Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27360 142 / 2e-45 Dynein light chain type 1 family protein (.1) AT3G16120 104 / 1e-30 Dynein light chain type 1 family protein (.1) AT1G52240 97 / 8e-28 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT4G15930 82 / 2e-21 Dynein light chain type 1 family protein (.1) AT5G20110 78 / 4e-19 Dynein light chain type 1 family protein (.1) AT1G23220 69 / 3e-16 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G407900 [exp] 153 / 1e-49 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 150 / 2e-48 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.003G052800 [exp] 95 / 5e-27 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 96 / 7e-27 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.008G219900 [exp] 81 / 4e-21 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 73 / 2e-17 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 71 / 2e-16 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 67 / 1e-15 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 67 / 2e-15 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038566 [exp] 150 / 1e-48 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10035868 [exp] 97 / 9e-28 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 97 / 2e-27 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 96 / 3e-27 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 94 / 2e-26 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 94 / 4e-26 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 88 / 6e-24 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10014484 [exp] 78 / 7e-19 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 74 / 2e-17 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 69 / 6e-16 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [poplar] [flax] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Potri.004G034000.1 pacid=42794628 polypeptide=Potri.004G034000.1.p locus=Potri.004G034000 ID=Potri.004G034000.1.v4.1 annot-version=v4.1 ATGTTAGAAGGCAAAGCTGTTGTTGGCGAGACTGACATGCTTCAAACCATGCAGCAGGATGCACTTCACTTAGCTGCGAAGGCCCTTGATATCTTTGATG TTACCGAGTCCACTGATATTGCCCGCTTCATAAAGAAGGACTTCGACAGGGTGCATGGACCAGGATGGCAATGCATTGTGGGGATGGATTTTGGTTCATT TGTGACCCATTACCATGGCTGCTTCATCCATTTCTGCATAGGAAACCTTGCAATCTTGCTTTTCAAAGGTTTGGGAAGAGAAGTTGTATCCAGTACTGGA GATTGTTGA
AA sequence Show only first row Show all	>Potri.004G034000.1 pacid=42794628 polypeptide=Potri.004G034000.1.p locus=Potri.004G034000 ID=Potri.004G034000.1.v4.1 annot-version=v4.1 MLEGKAVVGETDMLQTMQQDALHLAAKALDIFDVTESTDIARFIKKDFDRVHGPGWQCIVGMDFGSFVTHYHGCFIHFCIGNLAILLFKGLGREVVSSTG DC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27360			Dynein light chain type 1 fami...		Potri.004G034000 [exp]	0	1
					Potri.004G179822 [exp]	2.44	0.9105
AT3G26740		CCL	CCR-like (.1)		Potri.014G145500 [exp]	2.82	0.8908
AT1G61120		TPS4, GES, TPS0...	TERPENE SYNTHASE 4, GERANYLLIN...		Potri.004G037900 [exp]	10.67	0.7694
AT5G19820		EMB2734	embryo defective 2734, ARM rep...		Potri.017G137400 [exp]	10.95	0.8250
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G020500 [exp]	11.48	0.8615
AT1G68640	bZIP	PAN	PERIANTHIA, bZIP transcription...		Potri.010G128001 [exp]	13.85	0.7777
AT3G56630		CYP94D2	"cytochrome P450, family 94, s...		Potri.001G277301 [exp]	17.66	0.7475
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G013601 [exp]	19.89	0.7323
					Potri.018G011950 [exp]	26.45	0.8631
AT1G25440	CO	COL16	B-box type zinc finger protein...		Potri.010G125100 [exp]	26.94	0.8351	COL6.3

Compare expression of checked genes

Potri.004G034000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.