Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61105 234 / 6e-79 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G52900 206 / 4e-68 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G48770 70 / 7e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 68 / 2e-13 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72920 67 / 2e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G57670 67 / 4e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G17615 67 / 6e-13 Disease resistance protein (TIR-NBS class) (.1) AT1G72940 66 / 1e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 65 / 2e-12 Disease resistance protein (TIR-NBS class) (.1) AT1G17600 63 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G046800 [exp] 363 / 3e-130 AT1G61105 230 / 1e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.011G123100 [exp] 262 / 4e-90 AT1G52900 229 / 2e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.001G403800 [exp] 259 / 9e-89 AT1G52900 233 / 3e-78 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.005G004500 [exp] 82 / 4e-19 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 80 / 1e-17 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 80 / 2e-17 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001971 [exp] 79 / 3e-17 AT5G36930 427 / 3e-130 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.015G043501 [exp] 79 / 5e-17 AT1G27170 534 / 5e-176 transmembrane receptors;ATP binding (.1.2) Potri.T002400 [exp] 79 / 6e-17 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018470 [exp] 261 / 2e-89 AT1G61105 224 / 5e-75 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10011216 [exp] 261 / 3e-89 AT1G61105 228 / 2e-76 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10007829 [exp] 84 / 1e-18 AT5G36930 330 / 2e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007823 [exp] 83 / 2e-18 AT1G27170 322 / 3e-92 transmembrane receptors;ATP binding (.1.2) Lus10004747 [exp] 80 / 3e-17 AT5G36930 342 / 3e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10040576 [exp] 80 / 3e-17 AT1G27180 355 / 3e-103 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10012311 [exp] 79 / 6e-17 AT5G36930 354 / 6e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10000423 [exp] 76 / 9e-16 AT1G27180 338 / 5e-95 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10007821 [exp] 76 / 9e-16 AT5G36930 339 / 4e-98 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10013729 [exp] 74 / 2e-15 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.004G038200.1 pacid=42794025 polypeptide=Potri.004G038200.1.p locus=Potri.004G038200 ID=Potri.004G038200.1.v4.1 annot-version=v4.1 ATGCAGCAGCGTTCAGCATCAGCAGCCAAGAACTTATGTCGTAAAATCTTGAACCACCATAACCAAATCCAATCCCTTAAAAGACCACCCTGTGATGTGT TCATTAATCATCGGTGCATCGATACGAAGAGGACCATTTCTGGGTTGCTCTTTGATCATCTTTCTAGACTCAGGCTCCATCCATTTTTGGACAGCAAGAA CATGAGACCTGGTGACAAACTATTTGACAACATTGACAGAGCTATCCATGAATGTAAGGTTGGGGTTGCTGTATTTTCTCCCCGTTATTGTGATTCGTAC TTTTGTCTCCATGAACTGGCTTTATTAATGGAGACAAAGAAAAGAGTTATACCTATATTCTGTGATGTCAAACCGTCTCAGCTCCATGTCAAGGATAATG GGCTTTGTCCAGGCGAAGAGCTGCAAAGGTTTACATATGCTCTCGAAGAGGCAAAGTACACCGTTGGACTTACATTTGACACACTTGAAGGGAATTGGTC TCAATTCTTAACGACAGCAATGGATGCGGTTGTGCATAATTTGATCGAAGTGGATGCAGAAGCGAAACGCACAAGCACCGTACATATTTCATGA
AA sequence Show only first row Show all	>Potri.004G038200.1 pacid=42794025 polypeptide=Potri.004G038200.1.p locus=Potri.004G038200 ID=Potri.004G038200.1.v4.1 annot-version=v4.1 MQQRSASAAKNLCRKILNHHNQIQSLKRPPCDVFINHRCIDTKRTISGLLFDHLSRLRLHPFLDSKNMRPGDKLFDNIDRAIHECKVGVAVFSPRYCDSY FCLHELALLMETKKRVIPIFCDVKPSQLHVKDNGLCPGEELQRFTYALEEAKYTVGLTFDTLEGNWSQFLTTAMDAVVHNLIEVDAEAKRTSTVHIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61105			Toll-Interleukin-Resistance (T...		Potri.004G038200 [exp]	0	1
					Potri.014G059701 [exp]	5.65	0.8214
AT1G58420			Uncharacterised conserved prot...		Potri.014G006300 [exp]	17.17	0.7641
AT4G23880			unknown protein		Potri.003G140266 [exp]	20.59	0.7928
AT4G23880			unknown protein		Potri.003G140233 [exp]	26.32	0.7911
AT4G23880			unknown protein		Potri.003G140200 [exp]	30.85	0.7898
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Potri.007G066300 [exp]	43.72	0.7458
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.001G374300 [exp]	56.12	0.7096
AT1G42960			unknown protein		Potri.005G099233 [exp]	63.27	0.6744
AT1G12940		ATNRT2.5	nitrate transporter2.5 (.1)		Potri.012G087700 [exp]	70.81	0.6376
AT5G65600			Concanavalin A-like lectin pro...		Potri.016G031300 [exp]	83.51	0.6731	Pt-LEC.3

Compare expression of checked genes

Potri.004G038200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.