Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47160 313 / 1e-108 RING/U-box superfamily protein (.1.2) AT5G01520 308 / 1e-106 AtAIRP2, AIRP2 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) AT5G58787 296 / 8e-102 RING/U-box superfamily protein (.1.2) AT1G24440 211 / 3e-68 RING/U-box superfamily protein (.1) AT1G13195 206 / 3e-66 RING/U-box superfamily protein (.1.2) AT5G37270 45 / 2e-05 RING/U-box superfamily protein (.1) AT5G37250 44 / 2e-05 RING/U-box superfamily protein (.1) AT5G41350 44 / 3e-05 RING/U-box superfamily protein (.1) AT5G37230 43 / 7e-05 RING/U-box superfamily protein (.1) AT2G20030 43 / 9e-05 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G050700 [exp] 422 / 1e-151 AT3G47160 311 / 5e-108 RING/U-box superfamily protein (.1.2) Potri.016G115300 [exp] 347 / 4e-122 AT5G01520 339 / 6e-119 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Potri.006G099600 [exp] 341 / 9e-120 AT5G01520 324 / 4e-113 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Potri.009G045400 [exp] 335 / 2e-117 AT3G47160 381 / 1e-135 RING/U-box superfamily protein (.1.2) Potri.001G250800 [exp] 315 / 2e-109 AT3G47160 344 / 4e-121 RING/U-box superfamily protein (.1.2) Potri.008G181300 [exp] 228 / 4e-75 AT1G24440 352 / 1e-123 RING/U-box superfamily protein (.1) Potri.012G093300 [exp] 226 / 3e-74 AT1G24440 312 / 4e-108 RING/U-box superfamily protein (.1) Potri.010G052700 [exp] 226 / 3e-74 AT1G24440 349 / 1e-122 RING/U-box superfamily protein (.1) Potri.010G053000 [exp] 221 / 4e-72 AT1G13195 235 / 1e-77 RING/U-box superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004821 [exp] 329 / 7e-115 AT5G01520 387 / 5e-138 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Lus10002491 [exp] 327 / 7e-114 AT5G01520 386 / 1e-137 ABA Insensitive RING Protein 2, RING/U-box superfamily protein (.1.2) Lus10001209 [exp] 318 / 1e-110 AT3G47160 369 / 9e-131 RING/U-box superfamily protein (.1.2) Lus10005859 [exp] 318 / 1e-110 AT3G47160 372 / 5e-132 RING/U-box superfamily protein (.1.2) Lus10006447 [exp] 234 / 2e-77 AT3G47160 233 / 5e-77 RING/U-box superfamily protein (.1.2) Lus10011390 [exp] 233 / 3e-77 AT3G47160 233 / 3e-77 RING/U-box superfamily protein (.1.2) Lus10037053 [exp] 232 / 2e-76 AT3G47160 234 / 1e-77 RING/U-box superfamily protein (.1.2) Lus10036934 [exp] 230 / 8e-76 AT3G47160 239 / 2e-79 RING/U-box superfamily protein (.1.2) Lus10036937 [exp] 217 / 2e-70 AT1G24440 332 / 5e-116 RING/U-box superfamily protein (.1) Lus10006253 [exp] 216 / 4e-70 AT1G13195 336 / 4e-117 RING/U-box superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.004G041200.1 pacid=42796245 polypeptide=Potri.004G041200.1.p locus=Potri.004G041200 ID=Potri.004G041200.1.v4.1 annot-version=v4.1 ATGTATATAGGGTCTGTGAGAAAATCTTTCAAGGACTCTCTTAAAGTGCTTGAAGCTGATATTCAACATGCTAATACTCTGGCATCAGATATTTCAAGGG ATTATGATGGAGCCTGTCTTCAGATGAGAATGTCATATAGTCCAGCAGCACACCTGTTTCTTTTTCTTGTGCAGTGGACAGACTGCCATCTTGCTGGTGC ACTTGGACTGCTAAGGATCCTAATTTATAAGGTTTATGTGGATGGCACAACCACCATGACTACTCATGAAAGAAAAGCAAGTATCAGGGAGTTCTATGCT GTAATTTATCCCTCTTTATTGCAACTTCAAAGAGGGGTCACTGACACAGAAGATAAGGAACAGAAGGCGGTATGCATGGAAAGGTACCGAAGACGAGATG ATGAGGAACATAGGCAGCATGCTGATGTTGACATTGAAAGAGAAGAAGAATGTGGAATATGCATGGAGATGAATAGCAAGATTGTACTGCCCAACTGCCA CCATGCCATGTGCTTGAAATGTTACCGTGAATGGCGATCAAGATCCCAGTCATGCCCCTTCTGTCGTGACAGTCTCAAGAGAGTAAACTCTGGAGATCTC TGGGTGTTTACTGACAGCAAGGACATTGTGGACATGGCAACGGTGACAAGAGATAACCTAAGAAGGCTTTTTATGTATGTAGATAAGTTGCCTCTGATAA TTCCTGACAACCTTTTCGACACATACGATTCACACGTAAGATAG
AA sequence Show only first row Show all	>Potri.004G041200.1 pacid=42796245 polypeptide=Potri.004G041200.1.p locus=Potri.004G041200 ID=Potri.004G041200.1.v4.1 annot-version=v4.1 MYIGSVRKSFKDSLKVLEADIQHANTLASDISRDYDGACLQMRMSYSPAAHLFLFLVQWTDCHLAGALGLLRILIYKVYVDGTTTMTTHERKASIREFYA VIYPSLLQLQRGVTDTEDKEQKAVCMERYRRRDDEEHRQHADVDIEREEECGICMEMNSKIVLPNCHHAMCLKCYREWRSRSQSCPFCRDSLKRVNSGDL WVFTDSKDIVDMATVTRDNLRRLFMYVDKLPLIIPDNLFDTYDSHVR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47160			RING/U-box superfamily protein...		Potri.004G041200 [exp]	0	1
AT1G72820			Mitochondrial substrate carrie...		Potri.006G223600 [exp]	6.92	0.6427
AT3G54360			zinc ion binding (.1)		Potri.001G036400 [exp]	19.89	0.6499
AT2G39890		ATPROT1, ProT1	proline transporter 1 (.1.2)		Potri.010G194600 [exp]	26.30	0.6386	PtrProT2
AT5G54585			unknown protein		Potri.001G409600 [exp]	27.27	0.5580
AT4G13830		J20	DNAJ-like 20 (.1.2)		Potri.001G319100 [exp]	27.49	0.5723	Pt-DNAJ.2
AT1G13570			F-box/RNI-like superfamily pro...		Potri.017G107600 [exp]	42.93	0.5700
AT5G25110		CIPK25, SnRK3.2...	SNF1-RELATED PROTEIN KINASE 3....		Potri.006G263500 [exp]	43.06	0.6121	CIPK25.1
AT1G47330			CBS domain-containing protein ...		Potri.014G196900 [exp]	43.47	0.5633
AT1G15740			Leucine-rich repeat family pro...		Potri.006G061700 [exp]	49.20	0.6008
AT1G63930		ROH1	from the Czech 'roh' meaning '...		Potri.003G132100 [exp]	54.33	0.4699

Compare expression of checked genes

Potri.004G041200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.