Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53035 182 / 4e-60 unknown protein AT3G15358 173 / 1e-56 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G052900 [exp] 251 / 3e-87 AT3G15358 159 / 7e-51 unknown protein Potri.013G130100 [exp] 202 / 7e-68 AT1G53035 169 / 9e-55 unknown protein Potri.001G399900 [exp] 196 / 8e-66 AT1G53035 182 / 6e-60 unknown protein Potri.011G119200 [exp] 189 / 7e-63 AT1G53035 172 / 4e-56 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015439 [exp] 224 / 9e-77 AT3G15358 190 / 3e-63 unknown protein Lus10011176 [exp] 222 / 1e-75 AT3G15358 191 / 1e-63 unknown protein Lus10039835 [exp] 175 / 4e-57 AT1G53035 172 / 7e-56 unknown protein Lus10018600 [exp] 173 / 3e-56 AT1G53035 166 / 1e-53 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G044000.1 pacid=42793967 polypeptide=Potri.004G044000.1.p locus=Potri.004G044000 ID=Potri.004G044000.1.v4.1 annot-version=v4.1 ATGTCATCGGCTTTTCCTGTGATATGTATCCTCCACTCTCTCATAGCCATAACAAGTGGAACACTCATGATGTTCCACATGAAGGAAATCTACACCTTCA CACATGGGAATGAAACTGCAACGATTCTGATGGGGTCTACACCACAAGACCAGCTCCTGATCCGGACCTCTGATTCATTTTCTGGGCTGCTCCTGTTTGC TATTGGGTGGTTGATTTTCATGGTCTCTTTTATCAAGGACGGAGAGTTTCAATATTTCTTTGCAAAAGGGTGTACGCTTCTTCATGTTTTCATGGCTATT TGGAGGGTCAACTTTGAGAGGAGAGTTGAGGTGTTGGCTTGGGATTGGCTGAGACAGACAGTTGGTGATATCTTATTGGGTCTATCTTGGGTTCTCTTTC TTGTTTATTCTTGGAGAGAGAAGTATGATTAG
AA sequence Show only first row Show all	>Potri.004G044000.1 pacid=42793967 polypeptide=Potri.004G044000.1.p locus=Potri.004G044000 ID=Potri.004G044000.1.v4.1 annot-version=v4.1 MSSAFPVICILHSLIAITSGTLMMFHMKEIYTFTHGNETATILMGSTPQDQLLIRTSDSFSGLLLFAIGWLIFMVSFIKDGEFQYFFAKGCTLLHVFMAI WRVNFERRVEVLAWDWLRQTVGDILLGLSWVLFLVYSWREKYD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53035			unknown protein		Potri.004G044000 [exp]	0	1
AT2G19130			S-locus lectin protein kinase ...		Potri.013G096400 [exp]	5.47	0.8963
AT4G23060		IQD22	IQ-domain 22 (.1)		Potri.001G108800 [exp]	5.56	0.8544
AT3G49760	bZIP	ATBZIP5	basic leucine-zipper 5 (.1)		Potri.014G007100 [exp]	8.94	0.8647
AT5G10380		ATRING1, RING1	RING/U-box superfamily protein...		Potri.005G071300 [exp]	9.38	0.8761
AT5G53590			SAUR-like auxin-responsive pro...		Potri.001G306300 [exp]	18.33	0.8910
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.008G189400 [exp]	19.87	0.8910
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028400 [exp]	24.24	0.8871
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028532 [exp]	25.13	0.8852
AT2G19130			S-locus lectin protein kinase ...		Potri.013G096000 [exp]	25.23	0.8742
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G014100 [exp]	26.05	0.8858

Compare expression of checked genes

Potri.004G044000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.