Potri.004G044800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28280 223 / 9e-73 VQ motif-containing protein (.1.2)
AT2G33780 135 / 4e-39 VQ motif-containing protein (.1)
AT3G15300 124 / 2e-34 VQ motif-containing protein (.1)
AT5G53830 103 / 2e-26 VQ motif-containing protein (.1)
AT1G80450 54 / 1e-08 VQ motif-containing protein (.1)
AT5G08480 45 / 5e-06 VQ motif-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G053700 295 / 2e-100 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Potri.001G399100 177 / 1e-54 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.011G118200 176 / 3e-54 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.004G134200 68 / 1e-13 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.006G266700 57 / 1e-09 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.006G266600 53 / 2e-08 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Potri.018G016500 46 / 8e-06 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015315 184 / 3e-57 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10025443 140 / 4e-41 AT1G28280 154 / 2e-47 VQ motif-containing protein (.1.2)
Lus10005543 117 / 3e-31 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10041929 115 / 1e-30 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Lus10042423 64 / 5e-12 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10026247 64 / 8e-12 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10020092 46 / 9e-06 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.004G044800.1 pacid=42796700 polypeptide=Potri.004G044800.1.p locus=Potri.004G044800 ID=Potri.004G044800.1.v4.1 annot-version=v4.1
ATGGAAACCTCACCAAGACATCGAGATAATCAAAACCCACAGTCTCTGTTTCCTTCACCAACTAGCTACAGCAGCAGCAGCAACAGCAACAGCAACAGCA
GCTCCACCACCGCCACCACAAATAATGTTGCACTCAACAACAATATTAACCACCCTCCACCACTTCCATCACCCAAACCCATTTCCAGATCCGAATCCAC
TAACCCATACCCGACAACTTTTGTCCAAGCTGACAGTTCTTCCTTCAAACAAGTAGTCCAGATGTTGACTGGATCACCCAAACCCAAACCTACATGCACC
ACCACCACCACCACCACCACCACGACCCCCAACACCTCACAAGTCGACCCATTACCTAAAACCCACAACATCCCTCCAATTAAATCCATGCCCAAAAAGA
ACCAGTCTTCCGGGTTCAAGCTTTATGAACGTAGAAACTCACTCAAGAACCTCAAGATCAACCCTTTAAATCCAATTTTTGCCCAACCCAGTTCAGGTTT
TTCTTCAAGGAAACCAGAGATCCTCTCCCCAAGCATTCTCGATTTCCCAGCTCTTGTTTTAAGCCCGGTTACTCCTTTAATACCCGACCCGTTTGACCGA
TCCGGATCGGCAAAGTATACTAATAGTTTTAGTCCCATTAACACCTCCACCACCAACAACAATAACGTTGTTAATGCTGAGGCAATGGATACTGATGCAG
AGGAGAAAGCAATTAAAGAGAAAGGATTTTACTTGCACCCGTCACCCGGATCCTCACCAAGAGAAACGGAGCCCCGATTGCTGCCTCTATTTCCTATTAC
CTCACCAAGAATTTCAGGTTCTGTTAATCCTTCATCCTAA
AA sequence
>Potri.004G044800.1 pacid=42796700 polypeptide=Potri.004G044800.1.p locus=Potri.004G044800 ID=Potri.004G044800.1.v4.1 annot-version=v4.1
METSPRHRDNQNPQSLFPSPTSYSSSSNSNSNSSSTTATTNNVALNNNINHPPPLPSPKPISRSESTNPYPTTFVQADSSSFKQVVQMLTGSPKPKPTCT
TTTTTTTTTPNTSQVDPLPKTHNIPPIKSMPKKNQSSGFKLYERRNSLKNLKINPLNPIFAQPSSGFSSRKPEILSPSILDFPALVLSPVTPLIPDPFDR
SGSAKYTNSFSPINTSTTNNNNVVNAEAMDTDAEEKAIKEKGFYLHPSPGSSPRETEPRLLPLFPITSPRISGSVNPSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28280 VQ motif-containing protein (.... Potri.004G044800 0 1
AT1G19860 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Potri.007G013600 2.82 0.8068
AT4G26750 EXT-like extensin-like, hydroxyproline-... Potri.011G082000 5.38 0.8444
AT3G18930 RING/U-box superfamily protein... Potri.009G110000 6.70 0.8151
Potri.019G036280 7.14 0.8368
AT1G80450 VQ motif-containing protein (.... Potri.006G266600 11.74 0.7604
AT4G31170 Protein kinase superfamily pro... Potri.006G280000 12.32 0.8361
AT1G31870 unknown protein Potri.003G087200 12.96 0.8135
Potri.004G044750 16.43 0.7909
Potri.010G002600 16.94 0.7629
AT5G63550 DEK domain-containing chromati... Potri.012G102500 19.28 0.7953

Potri.004G044800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.