Potri.004G045400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28250 112 / 8e-34 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015429 127 / 3e-39 AT1G28250 132 / 2e-41 unknown protein
Lus10014006 123 / 1e-37 AT1G28250 133 / 7e-42 unknown protein
PFAM info
Representative CDS sequence
>Potri.004G045400.1 pacid=42794917 polypeptide=Potri.004G045400.1.p locus=Potri.004G045400 ID=Potri.004G045400.1.v4.1 annot-version=v4.1
ATGGAGAAAGACAAACAATCAGACATATCTTCAGCACAAGCAGTCTTACTTGGAGCATTAGCACCTGGGGTTAACGGTCCAACATGGAACACATTGAAAT
CAGCATTTTTGCTGTTGGGTTTGTGTCTTGCTATGATGCTTGTCTTAGCTTTCTCTTCCAGCGACTCTTCTTTGGTAATTCATGTTGGGTTTCTTGTAAC
AATCACAGCTACCCTCTTCTTGCTTCTTAGCTGGTTTCTTTCACAGACGGGTCTGGTTTCAATTGAACATCAAATGCGAGAAATGGATTTGGTGCCCGAA
GATCAGGGAGCTAAGCAAAAAGAGACGTGA
AA sequence
>Potri.004G045400.1 pacid=42794917 polypeptide=Potri.004G045400.1.p locus=Potri.004G045400 ID=Potri.004G045400.1.v4.1 annot-version=v4.1
MEKDKQSDISSAQAVLLGALAPGVNGPTWNTLKSAFLLLGLCLAMMLVLAFSSSDSSLVIHVGFLVTITATLFLLLSWFLSQTGLVSIEHQMREMDLVPE
DQGAKQKET

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28250 unknown protein Potri.004G045400 0 1
AT1G03330 Small nuclear ribonucleoprotei... Potri.004G219000 7.93 0.7247
AT5G64830 programmed cell death 2 C-term... Potri.007G080500 14.35 0.6899
AT3G07910 unknown protein Potri.009G071900 19.18 0.6513
AT3G05530 ATS6A.2, RPT5A regulatory particle triple-A A... Potri.013G016800 27.29 0.6479 RPT5.2
AT3G04680 CLPS3 CLP-similar protein 3 (.1.2) Potri.017G077200 32.03 0.6108
AT5G12240 unknown protein Potri.001G274400 33.94 0.5951
AT3G52390 TatD related DNase (.1.2) Potri.016G068400 40.47 0.6446
AT5G62530 ATP5CDH, ALDH12... ARABIDOPSIS THALIANA DELTA1-PY... Potri.015G064200 62.80 0.5932 FIS1.3
AT5G58575 unknown protein Potri.009G074400 91.48 0.5953
AT1G06110 SKIP16 SKP1/ASK-interacting protein 1... Potri.017G027000 107.23 0.5824

Potri.004G045400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.