Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53160 135 / 5e-41 SBP SPL4 squamosa promoter binding protein-like 4 (.1.2) AT2G33810 132 / 2e-40 SBP SPL3 squamosa promoter binding protein-like 3 (.1) AT3G15270 133 / 3e-40 SBP SPL5 squamosa promoter binding protein-like 5 (.1) AT1G69170 125 / 4e-35 SBP SPL6 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) AT3G60030 128 / 6e-35 SBP SPL12 squamosa promoter-binding protein-like 12 (.1) AT2G47070 121 / 1e-32 SBP SPL1 squamosa promoter binding protein-like 1 (.1) AT1G02065 117 / 3e-32 SBP SPL8 squamosa promoter binding protein-like 8 (.1.2) AT1G20980 119 / 5e-32 SBP ATSPL14, SPL1R2, FBR6, SPL14 squamosa promoter binding protein-like 14 (.1) AT2G42200 116 / 7e-32 SBP SPL9, AtSPL9 squamosa promoter binding protein-like 9 (.1) AT1G76580 116 / 7e-31 SBP SPL16 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G055900 [exp] 154 / 5e-49 AT2G33810 129 / 2e-39 squamosa promoter binding protein-like 3 (.1) Potri.001G398200 [exp] 142 / 2e-43 AT1G53160 162 / 6e-51 squamosa promoter binding protein-like 4 (.1.2) Potri.011G116800 [exp] 138 / 1e-41 AT3G15270 159 / 5e-49 squamosa promoter binding protein-like 5 (.1) Potri.007G138800 [exp] 130 / 6e-39 AT3G15270 140 / 4e-42 squamosa promoter binding protein-like 5 (.1) Potri.014G057800 [exp] 127 / 1e-35 AT1G27370 137 / 3e-36 squamosa promoter binding protein-like 10 (.1.2.3.4) Potri.002G142400 [exp] 126 / 3e-35 AT1G27360 141 / 5e-38 squamosa promoter-like 11 (.1.2.3.4) Potri.002G188700 [exp] 127 / 9e-35 AT2G47070 972 / 0.0 squamosa promoter binding protein-like 1 (.1) Potri.002G142200 [exp] 122 / 2e-34 AT1G02065 243 / 8e-79 squamosa promoter binding protein-like 8 (.1.2) Potri.014G057700 [exp] 122 / 2e-34 AT1G02065 247 / 3e-80 squamosa promoter binding protein-like 8 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015421 [exp] 135 / 2e-41 AT2G33810 128 / 4e-39 squamosa promoter binding protein-like 3 (.1) Lus10013999 [exp] 132 / 5e-40 AT2G33810 128 / 6e-39 squamosa promoter binding protein-like 3 (.1) Lus10039846 [exp] 124 / 4e-36 AT1G53160 129 / 8e-38 squamosa promoter binding protein-like 4 (.1.2) Lus10018610 [exp] 123 / 8e-36 AT3G15270 127 / 7e-37 squamosa promoter binding protein-like 5 (.1) Lus10005548 [exp] 120 / 5e-35 AT3G15270 133 / 1e-39 squamosa promoter binding protein-like 5 (.1) Lus10016275 [exp] 123 / 7e-35 AT2G42200 179 / 1e-53 squamosa promoter binding protein-like 9 (.1) Lus10007984 [exp] 124 / 4e-34 AT1G69170 167 / 2e-46 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10028181 [exp] 122 / 5e-34 AT1G02065 224 / 4e-71 squamosa promoter binding protein-like 8 (.1.2) Lus10021141 [exp] 124 / 8e-34 AT1G69170 168 / 9e-47 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10012020 [exp] 123 / 9e-34 AT2G42200 177 / 5e-51 squamosa promoter binding protein-like 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03110 [poplar] [flax] SBP SBP domain
Representative CDS sequence Show only first row Show all	>Potri.004G046700.1 pacid=42795608 polypeptide=Potri.004G046700.1.p locus=Potri.004G046700 ID=Potri.004G046700.1.v4.1 annot-version=v4.1 ATGGGAACAAGCAAAGCTGAAGGAAAGAGGAACTTGAAGGAAATAGAAGATGAAGAGGAAGATGATGATGAAGAAGATATTTATACTGGGTTAGGGTTTG GAGATGATGACAAGATCAAGAAGAAAGGAAGAACAGGGTCTGGTTGTGGTGGTGGTGGTGGTAGATCGTCGTCAAGTCCGCCTATTTCTTGTCAAGTAAA AAATTGCACAACTGATATGACTGATGCCAAGCGATACCATAAACGCCATAAGGTGTGTGAGTTCCATGCCAAAGCTTCTTCTGTACTTGTAAATGGAGTC GAGCAACGCTTTTGCCAGCAATGTAGCAGGTTCCATGATTTATCTGAGTTTGATGACAGCAAAAGGAGTTGCCGGAGGCGTTTAGCGGGGCACAATGAAC GGCGTAGGAAAAGCTCGTCTGACAACCAAGGAGAAGGCTCAAATTGA
AA sequence Show only first row Show all	>Potri.004G046700.1 pacid=42795608 polypeptide=Potri.004G046700.1.p locus=Potri.004G046700 ID=Potri.004G046700.1.v4.1 annot-version=v4.1 MGTSKAEGKRNLKEIEDEEEDDDEEDIYTGLGFGDDDKIKKKGRTGSGCGGGGGRSSSSPPISCQVKNCTTDMTDAKRYHKRHKVCEFHAKASSVLVNGV EQRFCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRKSSSDNQGEGSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53160	SBP	SPL4	squamosa promoter binding prot...		Potri.004G046700 [exp]	0	1
AT4G35160			O-methyltransferase family pro...		Potri.013G121300 [exp]	4.24	0.8239	OOMT2.16
AT3G49950	GRAS		GRAS family transcription fact...		Potri.005G145600 [exp]	4.89	0.8334
AT3G21670			Major facilitator superfamily ...		Potri.002G225500 [exp]	5.56	0.8740
					Potri.012G085800 [exp]	10.67	0.8441
					Potri.012G086200 [exp]	10.95	0.8492
AT1G24577			unknown protein		Potri.006G159300 [exp]	11.83	0.8114
					Potri.012G085901 [exp]	12.32	0.8426
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Potri.008G166100 [exp]	13.49	0.8332
AT1G68740		PHO1;H1	EXS (ERD1/XPR1/SYG1) family pr...		Potri.008G110800 [exp]	16.24	0.7995
AT4G31240			protein kinase C-like zinc fin...		Potri.006G279400 [exp]	24.49	0.8061

Compare expression of checked genes

Potri.004G046700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.