Potri.004G047100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28330 124 / 3e-37 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
AT2G33830 99 / 1e-27 Dormancy/auxin associated family protein (.1.2)
AT5G44300 82 / 5e-21 Dormancy/auxin associated family protein (.1)
AT1G56220 48 / 8e-08 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G54070 42 / 3e-05 Dormancy/auxin associated family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G024250 47 / 1e-07 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.013G014900 47 / 4e-07 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.001G164800 42 / 2e-05 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.003G070500 40 / 9e-05 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015418 107 / 6e-31 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013997 107 / 7e-31 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015318 87 / 6e-23 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10025446 72 / 3e-17 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Lus10013996 63 / 1e-13 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10020661 49 / 7e-08 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10031488 47 / 3e-07 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10015193 47 / 3e-07 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881 47 / 8e-07 AT5G27830 245 / 9e-80 unknown protein
Lus10008142 43 / 9e-06 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Potri.004G047100.6 pacid=42795771 polypeptide=Potri.004G047100.6.p locus=Potri.004G047100 ID=Potri.004G047100.6.v4.1 annot-version=v4.1
ATGGTTTTACTAGACAAGATGTGGGATGATGTTGTTGCTGGACCTCAGCCAGAACGTGGCCTTGGCAAGCTTAGAAAGATCAGCACCAGACCACTTAACA
TCAAAGATATTGACGTCGGAGAGGGGAGCAGTCCTGTTAATAAGTTTCAGAGGTCCATGACTATGCCAGGAACTCCAGGGACACCGACGACACCAGTGAC
CCCTACAACCCCAGTGTCGGCGCGTAGCAATGTTTGGAGGAGCGTGTTCCACCCTGGTAGCAACCTTGCTACTAAGAATATTGGTGCTCATGTTTTTGAC
AAGCCACAGCCTAACACACCCACTGTCTATGACTGGTACGTAAACCCATATTTGTTGAATTTTAGTCTCCTTCATATAATGGTTAATTACTTGCTCAGAA
GATTATTTTGTTCTCATGAAAAAGGGAAGGAAAAGAGTACTGTTTGA
AA sequence
>Potri.004G047100.6 pacid=42795771 polypeptide=Potri.004G047100.6.p locus=Potri.004G047100 ID=Potri.004G047100.6.v4.1 annot-version=v4.1
MVLLDKMWDDVVAGPQPERGLGKLRKISTRPLNIKDIDVGEGSSPVNKFQRSMTMPGTPGTPTTPVTPTTPVSARSNVWRSVFHPGSNLATKNIGAHVFD
KPQPNTPTVYDWYVNPYLLNFSLLHIMVNYLLRRLFCSHEKGKEKSTV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28330 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1,... Potri.004G047100 0 1
AT5G24890 unknown protein Potri.006G273100 1.41 0.8127
AT1G78310 VQ motif-containing protein (.... Potri.002G099900 8.24 0.7929
AT3G62210 EDA32 embryo sac development arrest ... Potri.013G003000 10.95 0.7590
AT4G28240 Wound-responsive family protei... Potri.019G116300 13.41 0.7425
AT2G30620 winged-helix DNA-binding trans... Potri.013G042700 14.38 0.7725 HON902
AT2G34730 myosin heavy chain-related (.1... Potri.001G466800 18.81 0.7627
AT1G75080 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Bras... Potri.002G133700 21.67 0.7112 BES1.2
AT5G48380 BIR1 BAK1-interacting receptor-like... Potri.008G078900 26.64 0.7687
AT1G34320 Protein of unknown function (D... Potri.013G115300 26.98 0.7322
AT4G17900 PLATZ transcription factor fam... Potri.001G141500 27.01 0.7575

Potri.004G047100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.