Plant FIBer expression Database

Potri.004G048000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.004G048000.1 pacid=42794037 polypeptide=Potri.004G048000.1.p locus=Potri.004G048000 ID=Potri.004G048000.1.v4.1 annot-version=v4.1
ATGGCTCAAATTCAATTCAGGACCAGTAGGATTGCAACACCACTTGAACACGCTACTGCAGAACAGTTTTACAGTGTCTTTAACAAGCCGCCATACCGCA
TACGTGAAATCTGCAGTCAGATTGGGATCAACATTCAATCTGCCACTGAAAAAAGCGCGACGATTCAATTCCAAACTTCCGATGGTGCCATCAAAACAGT
CGAAGGTACAGTGGAAAGGTCGGCAGACGACCCCTCGAGAACCGTGAGATTCTTAACATCGGAAGCAAACACAGTACCGGACAGCGTCCACGAGCTCAAA
TTGGAGGTTACAGATGATAGCAACCCTAGTGCAAAATGGATGGTCTCTAATATGCACTGCTCAACTCCTTATGATTACCTCCAACTTTTGGTTTCTGTCA
GCAAGGCTGTTGATAATTACTTTAGGCAAAATTAG
AA sequence
>Potri.004G048000.1 pacid=42794037 polypeptide=Potri.004G048000.1.p locus=Potri.004G048000 ID=Potri.004G048000.1.v4.1 annot-version=v4.1
MAQIQFRTSRIATPLEHATAEQFYSVFNKPPYRIREICSQIGINIQSATEKSATIQFQTSDGAIKTVEGTVERSADDPSRTVRFLTSEANTVPDSVHELK
LEVTDDSNPSAKWMVSNMHCSTPYDYLQLLVSVSKAVDNYFRQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G048000
[exp]
0 1
AT1G31330 PSAF photosystem I subunit F (.1) Potri.001G081500
[exp]
2.64 0.9742
AT3G18890 AtTic62 translocon at the inner envelo... Potri.004G150300
[exp]
5.47 0.9618 Pt-TIC62.1
AT3G04790 EMB3119 EMBRYO DEFECTIVE 3119, Ribose ... Potri.013G039400
[exp]
7.48 0.9529
AT5G58260 NdhN NADH dehydrogenase-like comple... Potri.013G160600
[exp]
9.16 0.9601
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Potri.019G087300
[exp]
9.59 0.9636
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Potri.003G038450
[exp]
10.95 0.9447
AT2G20570 GARP ATGLK1, GLK1, G... ARABIDOPSIS GOLDEN2-LIKE 1, GB... Potri.007G136901
[exp]
11.53 0.9414
AT4G26530 Aldolase superfamily protein (... Potri.001G468100
[exp]
12.64 0.9443 Pt-FBA.2
AT1G32470 Single hybrid motif superfamil... Potri.001G144800
[exp]
16.43 0.9550 gdcH4,GDCH.2
AT3G18890 AtTic62 translocon at the inner envelo... Potri.009G111323
[exp]
16.91 0.9467

Potri.004G048000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.