Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-GRX.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28480 95 / 1e-25 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT5G14070 65 / 6e-14 ROXY2 Thioredoxin superfamily protein (.1) AT1G03850 64 / 1e-13 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2) AT4G15690 57 / 3e-11 Thioredoxin superfamily protein (.1) AT4G15700 57 / 4e-11 Thioredoxin superfamily protein (.1) AT3G02000 57 / 6e-11 ROXY1 Thioredoxin superfamily protein (.1) AT4G15680 56 / 6e-11 Thioredoxin superfamily protein (.1) AT4G33040 57 / 9e-11 Thioredoxin superfamily protein (.1) AT4G15670 55 / 2e-10 Thioredoxin superfamily protein (.1) AT4G15660 55 / 2e-10 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G058800 [exp] 191 / 2e-63 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1) Potri.017G017300 [exp] 101 / 5e-28 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1) Potri.007G134800 [exp] 99 / 8e-27 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 72 / 9e-17 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 69 / 8e-16 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 66 / 3e-14 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 53 / 1e-09 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.006G226900 [exp] 53 / 3e-09 AT4G33040 184 / 8e-61 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 50 / 9e-09 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013962 [exp] 114 / 2e-33 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10018631 [exp] 97 / 2e-26 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1) Lus10039867 [exp] 96 / 7e-26 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 68 / 6e-15 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10017693 [exp] 64 / 3e-14 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 65 / 6e-14 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10033649 [exp] 61 / 1e-12 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 62 / 2e-12 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10024982 [exp] 55 / 4e-10 AT4G33040 174 / 8e-57 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 54 / 9e-10 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.004G049800.1 pacid=42794796 polypeptide=Potri.004G049800.1.p locus=Potri.004G049800 ID=Potri.004G049800.1.v4.1 annot-version=v4.1 ATGCAGGAAGCAATCCCATTTAGAGCCTACTCCCCGGCCACCACTGCCGGCAACCGGAGACTCCCGGGACGTGACTCCTGTGATCATGGTGGCGCTAATA GTACTAGTGCTGGACATGTGCTAATAGTGACCAATGGTCAAGAAAGTCATGTCCAAAAATTAGTGTCAGAGAATTCAATCGCTATATTTGGCAAGCGCGG ATGTTGCATGTGTCATGTTGTGAAGAAGTTGTTACTAGGGCTAGGTGTCAACCCACCGGTCTTCGAGGTGGAAGAGAAGGAGGAAGATTATGTGATCAAG GCGTTATCAATGATTAAAGGAGGGAAGGATGCTGATCAAGTGCAGTTTCCTGTGGTTTTTGTTGGAGGAAAATTGTTTGGTGGGCTGGAAAGAATCATTG CTTCTCATATTACTGGTGAGCTGGTGCCTATCTTGAAAGATGCCGGAGCTTTGTGGCTATGA
AA sequence Show only first row Show all	>Potri.004G049800.1 pacid=42794796 polypeptide=Potri.004G049800.1.p locus=Potri.004G049800 ID=Potri.004G049800.1.v4.1 annot-version=v4.1 MQEAIPFRAYSPATTAGNRRLPGRDSCDHGGANSTSAGHVLIVTNGQESHVQKLVSENSIAIFGKRGCCMCHVVKKLLLGLGVNPPVFEVEEKEEDYVIK ALSMIKGGKDADQVQFPVVFVGGKLFGGLERIIASHITGELVPILKDAGALWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Potri.004G049800 [exp]	0	1	Pt-GRX.2
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.008G174900 [exp]	3.00	0.9481
AT3G52600		ATCWINV2	cell wall invertase 2 (.1.2)		Potri.006G210600 [exp]	5.65	0.9397	BFRUCT1.1
AT2G19570		DESZ, AT-CDA1, ...	cytidine deaminase 1 (.1)		Potri.018G066400 [exp]	6.78	0.8920	CDA1.2
AT5G43940		PAR2, ATGSNOR1,...	PARAQUAT RESISTANT 2, sensitiv...		Potri.014G193800 [exp]	10.95	0.9298
AT5G05340			Peroxidase superfamily protein...		Potri.013G156500 [exp]	11.48	0.8872	Pt-PRX1.15
AT2G48020			Major facilitator superfamily ...		Potri.002G212900 [exp]	13.78	0.8960
AT2G28690			Protein of unknown function (D...		Potri.009G027100 [exp]	14.14	0.9346
AT1G14600	GARP		Homeodomain-like superfamily p...		Potri.010G099600 [exp]	14.42	0.8907
AT5G49450	bZIP	ATBZIP1	basic leucine-zipper 1 (.1)		Potri.010G142900 [exp]	16.43	0.9223
AT1G69500		CYP704B1	"cytochrome P450, family 704, ...		Potri.008G088900 [exp]	17.54	0.8711	CYP704B3

Compare expression of checked genes

Potri.004G049800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.