Plant FIBer expression Database

SYP61.1 (Potri.004G050800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol SYP61.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28490 298 / 9e-103 OSM1, ATSYP61, SYP61 syntaxin of plants 61 (.1.2)
AT1G27700 49 / 1e-06 Syntaxin/t-SNARE family protein (.1)
AT1G16240 44 / 4e-05 ATSYP51, SYP51 syntaxin of plants 51 (.1.2.3)
AT1G79590 44 / 5e-05 ATSYP52, SYP52 syntaxin of plants 52 (.1.2)
AT4G30240 44 / 6e-05 Syntaxin/t-SNARE family protein (.1)
AT2G18860 40 / 0.0007 Syntaxin/t-SNARE family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G059700
[exp]
363 / 2e-128 AT1G28490 310 / 2e-107 syntaxin of plants 61 (.1.2)
Potri.016G030100
[exp]
44 / 3e-05 AT1G79590 265 / 3e-90 syntaxin of plants 52 (.1.2)
Potri.006G032900
[exp]
41 / 0.0003 AT1G79590 249 / 1e-83 syntaxin of plants 52 (.1.2)
Potri.006G032800
[exp]
40 / 0.0008 AT1G79590 238 / 2e-79 syntaxin of plants 52 (.1.2)
Potri.014G019100
[exp]
40 / 0.001 AT1G27700 276 / 1e-91 Syntaxin/t-SNARE family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018642
[exp]
298 / 8e-103 AT1G28490 334 / 7e-117 syntaxin of plants 61 (.1.2)
Lus10039880
[exp]
288 / 1e-97 AT1G28490 271 / 4e-91 syntaxin of plants 61 (.1.2)
Lus10017686
[exp]
268 / 2e-90 AT1G28490 299 / 8e-103 syntaxin of plants 61 (.1.2)
Lus10016577
[exp]
41 / 0.0004 AT1G79590 319 / 1e-111 syntaxin of plants 52 (.1.2)
Lus10007766
[exp]
40 / 0.0009 AT1G27700 292 / 2e-98 Syntaxin/t-SNARE family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
PF09177 Syntaxin-6_N Syntaxin 6, N-terminal
Representative CDS sequence
>Potri.004G050800.1 pacid=42795352 polypeptide=Potri.004G050800.1.p locus=Potri.004G050800 ID=Potri.004G050800.1.v4.1 annot-version=v4.1
ATGTCGTCAGCACAAGACCCGTTTTATATTGTGAAAGAGGAGATTCAAGAATCTATTGACAAGTTGCAATCTTCATTTCACCAATGGGAACGGATTTCTT
CTGACTCGGGAGAGCAAGTGCGTCTTACAAAGGAGCTGCTTGCTGCTTGTGAGAGCATTGAGTGGAAGGTGGATGAATTGGACAAAGCAATTTCTGTAGC
AGCTAGAGACCCTTCTTGGTATGGCATTGATGAAGCAGAACTTGAAAAACGGAGGAGATGGACCAGCACTGCTCGCACTCAGGTGGGCAATGTGAAGAAA
GCAGTAGTAGCTGGAAAAGAGTTGAATCTCAGTGGAACTGCTAGTGTGAATGGGATGCGCAGAGAATTAATGAGGATGCCTGATGCACAACAGACTGACA
AATCCAATCAGTACACTCAAGATAACGATGATTTTATACAATCAGAATCAGATAGACAAATGCTTCTTATAAAGCAACAGGATGACGAGTTGGATGAGCT
TAGTGCAAGTGTGGAGAGAATTGGAGGTGTTGGCCTAACCATACACGAAGAACTACTTGCACAGGAAAGGATCATAGGTGATTTGGATACGGAAATGGAC
ACTACATCAAATCGACTTGATTTTGTTCAGAAAAAAGTGGCTATGGTCATGAAGAAGGCCAGCGCAAAGGGGCAACTTATGATGATAGTGTTCTTGGTAG
TTTTGTTCATCATCCTATTTGTTCTGGTCTTCTTGACCTAA
AA sequence
>Potri.004G050800.1 pacid=42795352 polypeptide=Potri.004G050800.1.p locus=Potri.004G050800 ID=Potri.004G050800.1.v4.1 annot-version=v4.1
MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISSDSGEQVRLTKELLAACESIEWKVDELDKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKK
AVVAGKELNLSGTASVNGMRRELMRMPDAQQTDKSNQYTQDNDDFIQSESDRQMLLIKQQDDELDELSASVERIGGVGLTIHEELLAQERIIGDLDTEMD
TTSNRLDFVQKKVAMVMKKASAKGQLMMIVFLVVLFIILFVLVFLT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28490 OSM1, ATSYP61, ... syntaxin of plants 61 (.1.2) Potri.004G050800
[exp]
0 1 SYP61.1
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Potri.010G039700
[exp]
3.16 0.8742 Pt-PP2.1
AT1G09330 ECHIDNA, ECH unknown protein Potri.013G006250
[exp]
4.35 0.8989
AT4G00840 DHHC-type zinc finger family p... Potri.014G104000
[exp]
5.47 0.8443
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Potri.006G171500
[exp]
7.48 0.8743
AT2G37975 Yos1-like protein (.1) Potri.010G194400
[exp]
10.58 0.8261
AT5G58030 Transport protein particle (TR... Potri.018G110000
[exp]
11.66 0.8684
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Potri.004G194400
[exp]
12.96 0.8608
AT5G49540 Rab5-interacting family protei... Potri.010G148600
[exp]
16.06 0.8732
AT1G32050 SCAMP family protein (.1) Potri.001G134100
[exp]
18.52 0.8702
AT3G12955 SAUR-like auxin-responsive pro... Potri.011G143400
[exp]
19.74 0.8610 SAUR5

Potri.004G050800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.