Potri.004G051300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28540 103 / 7e-30 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025433 114 / 6e-34 AT1G28540 111 / 7e-33 unknown protein
Lus10042196 62 / 2e-13 AT1G28540 71 / 1e-16 unknown protein
Lus10024553 52 / 5e-10 AT1G28540 48 / 6e-09 unknown protein
PFAM info
Representative CDS sequence
>Potri.004G051300.3 pacid=42796219 polypeptide=Potri.004G051300.3.p locus=Potri.004G051300 ID=Potri.004G051300.3.v4.1 annot-version=v4.1
ATGTCAGATCCCCAAAACCCTAATCCCCAAAACCTTCCTTCTTCTTCTGCTTCTTCTTCATCTAACAAAAACCCCACCGAAATTAAACCCGGCAACGGCA
ATTACTCGGGTCAAAAGGTCCATTTCTCGAACCCACCCGAGACAACAAATCCGGACCCTGCAACACTGAGGGAACAATGGAGGTTTGCTATTAGGCAGTA
CAGTAAATGGTATTCTCACGCTTGGGGCACTGCTATTCTGGCTGGTGTTTCGTTTTTCGCGCTTGGCTGGATCATCAAGGGATCCAATCCTTTACCCTCT
TCCAGGACTGATGATTCCTCTTCTTCGCCTTCTAATGATGCTAAAGAAAAAGCAACTCGATAA
AA sequence
>Potri.004G051300.3 pacid=42796219 polypeptide=Potri.004G051300.3.p locus=Potri.004G051300 ID=Potri.004G051300.3.v4.1 annot-version=v4.1
MSDPQNPNPQNLPSSSASSSSNKNPTEIKPGNGNYSGQKVHFSNPPETTNPDPATLREQWRFAIRQYSKWYSHAWGTAILAGVSFFALGWIIKGSNPLPS
SRTDDSSSSPSNDAKEKATR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G28540 unknown protein Potri.004G051300 0 1
AT3G13340 Transducin/WD40 repeat-like su... Potri.002G233700 4.24 0.6481
AT3G13340 Transducin/WD40 repeat-like su... Potri.014G147400 24.00 0.5337
AT3G01170 Ribosomal protein L34e superfa... Potri.004G121900 34.72 0.5555
AT5G54540 Uncharacterised conserved prot... Potri.011G130000 35.41 0.5698
AT5G50930 Histone superfamily protein (.... Potri.015G105900 39.79 0.5735
AT2G06025 Acyl-CoA N-acyltransferases (N... Potri.006G142100 44.49 0.5608
AT5G06710 HD HAT14 homeobox from Arabidopsis thal... Potri.001G229700 61.13 0.5075
AT2G01490 phytanoyl-CoA dioxygenase (Phy... Potri.006G222800 69.34 0.5504
AT5G54585 unknown protein Potri.001G409600 76.34 0.5083
AT4G14270 unknown protein Potri.010G182800 107.47 0.4986

Potri.004G051300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.