Potri.004G053600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G063600 155 / 1e-48 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G053600.1 pacid=42795861 polypeptide=Potri.004G053600.1.p locus=Potri.004G053600 ID=Potri.004G053600.1.v4.1 annot-version=v4.1
ATGAAAACAGTTTGCCAAAATCAAAACACTGCTATCATTTTCCCACTTCAAAATTTCACCTCCCATTTCCCCTCCAAAGTGCCACCATTATATATACCTC
TTCTTGCCCCTCCCATCTCATCACCACCTCTTCCTCCCCCCCCTCTCTCTCTCACGCTATCTCTTGCAATGGCTGTCCTCTTTCAGAGCCAGTATGACAA
CAAGGAGAACGTCCCCCCTTTCTTTCCAAAGCAAGATGCTTTATTAGTTGCTAAATCTAAATCTCCACTCCCTACAAGCAATCAAAGAAGAGTCAGGAGA
CCGCTTGAGGACATTACCAACCTCTTGAATCAAGAAATCCTTCTGAGGTCAGTTCTTGATGATAGGATCCGTATTTTACATTCACTTCCTTCAGCTTCCA
GACTGAAATGTGGAAAGAGGAGAGCTGAAGATGGTGCTGACCCGTCCTGCAAGAAGACCCAGTTGCTGCATCCGAGCAAAAATTTTAGATAG
AA sequence
>Potri.004G053600.1 pacid=42795861 polypeptide=Potri.004G053600.1.p locus=Potri.004G053600 ID=Potri.004G053600.1.v4.1 annot-version=v4.1
MKTVCQNQNTAIIFPLQNFTSHFPSKVPPLYIPLLAPPISSPPLPPPPLSLTLSLAMAVLFQSQYDNKENVPPFFPKQDALLVAKSKSPLPTSNQRRVRR
PLEDITNLLNQEILLRSVLDDRIRILHSLPSASRLKCGKRRAEDGADPSCKKTQLLHPSKNFR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G053600 0 1
AT5G24330 SDG34, ATXR6 SET DOMAIN PROTEIN 34, ARABIDO... Potri.012G018300 3.00 0.8889 SDG933
Potri.011G063600 7.34 0.8800
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.008G187000 17.37 0.9025
AT1G26840 ORC6, ATORC6 ARABIDOPSIS THALIANA ORIGIN RE... Potri.011G083700 17.94 0.8683
AT2G26520 unknown protein Potri.014G035400 17.97 0.8653
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.018G115400 29.32 0.8847 Pt-RPS11.3
AT3G48160 E2F_DP E2FE, E2L3, DEL... E2F-LIKE 3, DP-E2F-like 1 (.1.... Potri.012G075300 32.71 0.8739 DEL2,DEL1.2
AT4G18100 Ribosomal protein L32e (.1) Potri.002G249000 39.42 0.8759
AT2G09990 Ribosomal protein S5 domain 2-... Potri.008G150000 41.08 0.8753
AT5G01910 unknown protein Potri.016G138300 42.53 0.8744

Potri.004G053600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.