Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45890 254 / 6e-85 SAG12 senescence-associated gene 12 (.1) AT5G50260 238 / 2e-78 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G48340 236 / 2e-77 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT3G49340 227 / 3e-74 Cysteine proteinases superfamily protein (.1) AT2G27420 224 / 5e-73 Cysteine proteinases superfamily protein (.1) AT3G48350 222 / 6e-72 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT2G34080 221 / 7e-72 Cysteine proteinases superfamily protein (.1) AT1G06260 220 / 2e-71 Cysteine proteinases superfamily protein (.1) AT4G35350 219 / 5e-71 XCP1 xylem cysteine peptidase 1 (.1.2) AT1G47128 220 / 4e-70 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G056308 [exp] 381 / 6e-137 AT5G45890 254 / 7e-85 senescence-associated gene 12 (.1) Potri.004G056050 [exp] 374 / 4e-134 AT5G45890 263 / 3e-88 senescence-associated gene 12 (.1) Potri.004G056200 [exp] 338 / 5e-118 AT5G45890 420 / 1e-147 senescence-associated gene 12 (.1) Potri.004G056316 [exp] 331 / 3e-115 AT5G45890 419 / 3e-147 senescence-associated gene 12 (.1) Potri.004G056258 [exp] 331 / 4e-115 AT5G45890 417 / 8e-147 senescence-associated gene 12 (.1) Potri.004G056366 [exp] 330 / 1e-114 AT5G45890 416 / 5e-146 senescence-associated gene 12 (.1) Potri.004G056100 [exp] 328 / 3e-114 AT5G45890 419 / 2e-147 senescence-associated gene 12 (.1) Potri.004G056500 [exp] 326 / 3e-113 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1) Potri.004G056000 [exp] 326 / 3e-113 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033040 [exp] 255 / 4e-85 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10006459 [exp] 244 / 1e-82 AT5G50260 307 / 4e-105 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10013674 [exp] 248 / 4e-82 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10006542 [exp] 247 / 4e-82 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10015285 [exp] 246 / 4e-82 AT5G45890 406 / 8e-143 senescence-associated gene 12 (.1) Lus10029799 [exp] 247 / 5e-82 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1) Lus10003275 [exp] 247 / 6e-82 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10032406 [exp] 246 / 7e-82 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10042295 [exp] 246 / 1e-81 AT5G45890 402 / 7e-141 senescence-associated gene 12 (.1) Lus10020723 [exp] 246 / 1e-81 AT5G45890 398 / 3e-139 senescence-associated gene 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease
Representative CDS sequence Show only first row Show all	>Potri.004G056301.1 pacid=42796667 polypeptide=Potri.004G056301.1.p locus=Potri.004G056301 ID=Potri.004G056301.1.v4.1 annot-version=v4.1 ATGGTAGGATGTTGCTGGGCATTTTCCGCAGTGGCAGCAATAGAAGGAATTATAAAGCTTAAGACAGGTAACTTAATATCATTATCAAAGCAACAGCTTG TGAACCGTGATGTTGGAAATAAAGGTTGTCACGGTGGTCTCATGGACACTGCTTTCCAATATATTATACGAAACGAAGGGCTAACAAGTGAAGATAATTA CCCCTACCAAGGAGTAGATGGCACTTGCAGTAGCGAGAAGGCAGCATCTATTGCAGCAGAAATAACAGGGGATGAAAACGCGCCAAAGAATAATGAAAAC GCTCTCCTGCAAGCTGTGGCCAAACAGCCAGTATCTGTTGGTGTTGACGGTGGTGGGAACGATTTCCAGTTTTATAAAAGTGGTGTCTTCAATGGGGATT GTGGGACACAGCAAAACCACGCTGTTACTGCAATTGGATATGGTACTGACAGTGATGGGACTGATTATTGGTTGGTGAAGAATTCATGGGGAACCAGTTG GGGTGAAAGTGGGTATACGAGGATGCAAAGAGGCATCGGTGCAAGCGAAGGGCTATGTGGCGTTGCCATGGATGCTTCTTATCCAACTGCATGA
AA sequence Show only first row Show all	>Potri.004G056301.1 pacid=42796667 polypeptide=Potri.004G056301.1.p locus=Potri.004G056301 ID=Potri.004G056301.1.v4.1 annot-version=v4.1 MVGCCWAFSAVAAIEGIIKLKTGNLISLSKQQLVNRDVGNKGCHGGLMDTAFQYIIRNEGLTSEDNYPYQGVDGTCSSEKAASIAAEITGDENAPKNNEN ALLQAVAKQPVSVGVDGGGNDFQFYKSGVFNGDCGTQQNHAVTAIGYGTDSDGTDYWLVKNSWGTSWGESGYTRMQRGIGASEGLCGVAMDASYPTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.004G056301 [exp]	0	1
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.004G056308 [exp]	1.00	0.7529
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Potri.019G028400 [exp]	31.74	0.6992
ATMG00640		ATMG00640.1, OR...	hydrogen ion transporting ATP ...		Potri.007G062422 [exp]	40.64	0.6935
AT1G14430			glyoxal oxidase-related protei...		Potri.010G034200 [exp]	43.01	0.6530
					Potri.007G061560 [exp]	44.89	0.6875
ATCG01250		ATCG01250.1, ND...	NADH-Ubiquinone/plastoquinone ...		Potri.008G207100 [exp]	45.78	0.6924
					Potri.007G062162 [exp]	58.47	0.6755
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Potri.005G154512 [exp]	58.88	0.6782
					Potri.007G061901 [exp]	79.10	0.6612
AT1G55810		UKL3	uridine kinase-like 3 (.1.2.3)		Potri.001G467800 [exp]	82.66	0.6373

Compare expression of checked genes

Potri.004G056301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.