Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-DOF2.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29160 186 / 7e-61 DOF AtDof1. 5 Dof-type zinc finger DNA-binding family protein (.1) AT2G34140 180 / 1e-58 DOF AtDof2. 3 Dof-type zinc finger DNA-binding family protein (.1) AT5G62430 124 / 3e-35 DOF CDF1, AtDof5,5 cycling DOF factor 1 (.1) AT3G47500 125 / 2e-34 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) AT1G69570 124 / 2e-34 DOF AtDof1,10 Dof-type zinc finger DNA-binding family protein (.1) AT5G39660 121 / 4e-33 DOF CDF2, AtDof5. 2 cycling DOF factor 2 (.1.2) AT1G26790 115 / 3e-31 DOF AtDof1,3 Dof-type zinc finger DNA-binding family protein (.1) AT3G61850 100 / 5e-26 DOF DAG1, AtDof3,7 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4) AT4G24060 99 / 3e-25 DOF AtDof4,6 Dof-type zinc finger DNA-binding family protein (.1) AT2G28810 97 / 1e-24 DOF AtDof2. 2 Dof-type zinc finger DNA-binding family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G065900 [exp] 266 / 6e-93 AT1G29160 155 / 7e-49 Dof-type zinc finger DNA-binding family protein (.1) Potri.017G084600 [exp] 121 / 6e-33 AT5G39660 314 / 3e-102 cycling DOF factor 2 (.1.2) Potri.008G087800 [exp] 120 / 1e-32 AT3G47500 249 / 2e-77 cycling DOF factor 3 (.1) Potri.004G121800 [exp] 120 / 1e-32 AT3G47500 293 / 5e-94 cycling DOF factor 3 (.1) Potri.013G066700 [exp] 119 / 5e-32 AT3G47500 157 / 2e-42 cycling DOF factor 3 (.1) Potri.010G167600 [exp] 119 / 6e-32 AT3G47500 257 / 2e-80 cycling DOF factor 3 (.1) Potri.019G040700 [exp] 117 / 2e-31 AT5G39660 154 / 1e-41 cycling DOF factor 2 (.1.2) Potri.002G174300 [exp] 98 / 3e-25 AT3G61850 229 / 8e-74 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4) Potri.014G100900 [exp] 97 / 3e-25 AT3G61850 233 / 1e-75 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013905 [exp] 176 / 7e-57 AT2G34140 171 / 9e-55 Dof-type zinc finger DNA-binding family protein (.1) Lus10001896 [exp] 166 / 3e-53 AT2G34140 172 / 3e-55 Dof-type zinc finger DNA-binding family protein (.1) Lus10020315 [exp] 125 / 2e-34 AT5G62430 201 / 7e-60 cycling DOF factor 1 (.1) Lus10020314 [exp] 123 / 2e-34 AT5G62430 196 / 8e-59 cycling DOF factor 1 (.1) Lus10005677 [exp] 124 / 3e-34 AT5G62430 199 / 3e-59 cycling DOF factor 1 (.1) Lus10034461 [exp] 122 / 2e-33 AT3G47500 331 / 2e-109 cycling DOF factor 3 (.1) Lus10019093 [exp] 122 / 2e-33 AT3G47500 330 / 8e-109 cycling DOF factor 3 (.1) Lus10037167 [exp] 120 / 6e-33 AT5G39660 214 / 5e-65 cycling DOF factor 2 (.1.2) Lus10010113 [exp] 100 / 8e-26 AT3G61850 194 / 5e-60 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4) Lus10012619 [exp] 100 / 1e-25 AT3G61850 201 / 2e-62 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02701 [poplar] [flax] zf-Dof Dof domain, zinc finger
Representative CDS sequence Show only first row Show all	>Potri.004G056900.1 pacid=42794448 polypeptide=Potri.004G056900.1.p locus=Potri.004G056900 ID=Potri.004G056900.1.v4.1 annot-version=v4.1 ATGGCTAGCCAAGAAGAGGGCATCAAGCTCTTTGGAGCAACAATTACGTTGCATGATAAACAAGAAGGTAATAAAGAAGATCCAAACAAGGAAAATCCAA CCACTGACAAGAGACCAGAGAAGGTCATACCTTGCCCTAGATGTAAGAGCATGGAGACCAAGTTTTGTTACTTCAACAACTACAATGTTAACCAGCCAAG ATATTTCTGTAAGGGCTGCCAGAGGTACTGGACGGCAGGTGGGGCCCTACGAAATGTTCCTGTGGGTGCCGGCCGCCGGAAAACTAAGCCACCTGGCCGG GTTGGTCTTGACGGTTACTCGGAGGGGTGCTTGTATGATGGCTCTGGTGGGGTTCACCGATTTGAGCTAGATGGGATGGTTTTGGAGGAGTGGCACTTGG CAACGACCCATGGCAGTTCCCGTCATGTTTTCCCCGTGAAGCGGCGGAGGAGCGGTGGCTCAGGTGGTCACACTTGTTGA
AA sequence Show only first row Show all	>Potri.004G056900.1 pacid=42794448 polypeptide=Potri.004G056900.1.p locus=Potri.004G056900 ID=Potri.004G056900.1.v4.1 annot-version=v4.1 MASQEEGIKLFGATITLHDKQEGNKEDPNKENPTTDKRPEKVIPCPRCKSMETKFCYFNNYNVNQPRYFCKGCQRYWTAGGALRNVPVGAGRRKTKPPGR VGLDGYSEGCLYDGSGGVHRFELDGMVLEEWHLATTHGSSRHVFPVKRRRSGGSGGHTC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29160	DOF	AtDof1. 5	Dof-type zinc finger DNA-bindi...		Potri.004G056900 [exp]	0	1	Pt-DOF2.2
AT1G65430		ATARI8, ARI8	ARABIDOPSIS ARIADNE 8, ARIADNE...		Potri.002G131200 [exp]	3.87	0.8296
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Potri.008G136100 [exp]	5.09	0.8302	RDR902,Pt-RDRP.1
AT4G36750			Quinone reductase family prote...		Potri.004G151100 [exp]	10.39	0.8251
AT3G52490			Double Clp-N motif-containing ...		Potri.016G071800 [exp]	11.61	0.8404
AT3G60720		PDLP8	plasmodesmata-located protein ...		Potri.014G067000 [exp]	12.48	0.8446
AT5G23370			GRAM domain-containing protein...		Potri.005G088300 [exp]	12.68	0.8356
					Potri.009G080100 [exp]	13.78	0.8030
					Potri.008G062950 [exp]	14.28	0.7836
AT2G23060			Acyl-CoA N-acyltransferases (N...		Potri.007G054200 [exp]	15.74	0.8061	Pt-HLS1.2
					Potri.001G058500 [exp]	16.24	0.8000

Compare expression of checked genes

Potri.004G056900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.