Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL36.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37600 173 / 2e-57 Ribosomal protein L36e family protein (.1.2) AT3G53740 172 / 3e-57 Ribosomal protein L36e family protein (.1.2.3.4) AT5G02450 167 / 2e-55 Ribosomal protein L36e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G066000 [exp] 209 / 5e-72 AT3G53740 173 / 2e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.012G142600 [exp] 209 / 7e-72 AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4) Potri.015G145800 [exp] 209 / 8e-72 AT3G53740 173 / 1e-57 Ribosomal protein L36e family protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040728 [exp] 182 / 5e-61 AT3G53740 159 / 5e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10024402 [exp] 180 / 3e-60 AT3G53740 161 / 9e-53 Ribosomal protein L36e family protein (.1.2.3.4) Lus10025342 [exp] 180 / 3e-60 AT3G53740 161 / 9e-53 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016466 [exp] 179 / 8e-60 AT3G53740 160 / 2e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10016501 [exp] 179 / 4e-59 AT3G53740 160 / 9e-52 Ribosomal protein L36e family protein (.1.2.3.4) Lus10040766 [exp] 185 / 8e-59 AT3G53740 162 / 2e-49 Ribosomal protein L36e family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01158 [poplar] [flax] Ribosomal_L36e Ribosomal protein L36e
Representative CDS sequence Show only first row Show all	>Potri.004G057000.2 pacid=42794710 polypeptide=Potri.004G057000.2.p locus=Potri.004G057000 ID=Potri.004G057000.2.v4.1 annot-version=v4.1 ATGGCTCCCAAACAGCCAAACACTGGCCTCTTTGTAGGATTGAACAAGGGGCACATTGTGACCAAGAAGGAGCTAGCTCCACGCCCTTCTGATCGCAAAG GGAAAACCAGTAAGAGGGTACTCTTTGTCAGGAGTTTGATCAGGGAAGTTGCTGGTTTTGCACCATATGAGAAGAGGATCACTGAGCTTCTTAAGGTTGG CAAGGATAAGCGTGCATTGAAGGTAGCTAAAAGAAAGTTGGGCACACACAAGAGGGCTAAGAAGAAGCGTGAGGAGATGTCTAATGTTCTCCGCAAGATG AGGGCTGCTGGAGGTGCTGAGAAGAAGAAGTGA
AA sequence Show only first row Show all	>Potri.004G057000.2 pacid=42794710 polypeptide=Potri.004G057000.2.p locus=Potri.004G057000 ID=Potri.004G057000.2.v4.1 annot-version=v4.1 MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRVLFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSNVLRKM RAAGGAEKKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37600			Ribosomal protein L36e family ...		Potri.004G057000 [exp]	0	1	RPL36.1
AT5G52650			RNA binding Plectin/S10 domain...		Potri.013G027900 [exp]	1.73	0.9388
AT5G59850			Ribosomal protein S8 family pr...		Potri.001G118100 [exp]	3.00	0.9458	Pt-WRP15.2
AT5G04800			Ribosomal S17 family protein (...		Potri.008G017300 [exp]	5.47	0.9449
AT4G27090			Ribosomal protein L14 (.1)		Potri.002G035700 [exp]	6.48	0.9289
AT5G27700			Ribosomal protein S21e (.1)		Potri.013G017600 [exp]	6.63	0.9383
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.003G161200 [exp]	8.77	0.9243
AT1G61570		TIM13	translocase of the inner mitoc...		Potri.001G452100 [exp]	10.29	0.9000	TIM13.1
AT5G27430			Signal peptidase subunit (.1)		Potri.005G036200 [exp]	10.77	0.8684	Pt-SPP.1
AT3G13580			Ribosomal protein L30/L7 famil...		Potri.010G250900 [exp]	12.00	0.9308	Pt-RPL7.4
AT3G16780			Ribosomal protein L19e family ...		Potri.015G029500 [exp]	12.48	0.9122

Compare expression of checked genes

Potri.004G057000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.