Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18800 392 / 9e-141 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G45750 389 / 9e-140 AtRABA1c RAB GTPase homolog A1C (.1) AT1G16920 369 / 7e-132 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 357 / 9e-127 AtRABA1f RAB GTPase homolog A1F (.1) AT1G06400 355 / 6e-126 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT3G15060 353 / 3e-125 AtRABA1g RAB GTPase homolog A1G (.1) AT1G28550 347 / 4e-123 AtRABA1i RAB GTPase homolog A1I (.1) AT2G33870 338 / 2e-119 ArRABA1h RAB GTPase homolog A1H (.1) AT4G18430 337 / 3e-119 AtRABA1e RAB GTPase homolog A1E (.1) AT1G07410 309 / 4e-108 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G070300 [exp] 434 / 1e-157 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.001G374000 [exp] 359 / 1e-127 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 355 / 3e-126 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 354 / 7e-126 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.011G061300 [exp] 350 / 3e-124 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.006G000300 [exp] 312 / 2e-109 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.003G004100 [exp] 309 / 4e-108 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.016G000400 [exp] 309 / 5e-108 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 298 / 2e-103 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029253 [exp] 410 / 8e-148 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 404 / 1e-145 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10017679 [exp] 361 / 2e-128 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10020746 [exp] 360 / 3e-128 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029789 [exp] 360 / 6e-128 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10002178 [exp] 359 / 8e-128 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 355 / 3e-126 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 352 / 5e-125 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 346 / 1e-122 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1) Lus10039895 [exp] 331 / 1e-116 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.004G061000.1 pacid=42794803 polypeptide=Potri.004G061000.1.p locus=Potri.004G061000 ID=Potri.004G061000.1.v4.1 annot-version=v4.1 ATGGCAGGGTACAGAGCCGAAGATGACTATGATTACCTGTTCAAGGTTGTACTTATTGGCGACTCAGGTGTGGGCAAGTCCAATCTTCTTTCAAGATTCA CTCGTAATGAGTTCAGTTTGGAGTCGAAGTCTACTATTGGTGTTGAGTTCGCTACTCGCAGCTTGAATGTTGATTCCAAGGTCATTAAGGCCCAGATTTG GGACACTGCTGGCCAAGAAAGGTACCGTGCCATAACTAGTGCTTATTACCGGGGAGCAGTGGGTGCATTGCTTGTGTATGATGTTACCCGGCACTCAACA TTTGAAAATGTTGAAAGGTGGCTAAGGGAGTTGAGGGATCATACAGATCCTAACATTGTTGTCATGCTCATCGGCAATAAATCAGATCTTCGCCACCTGG TGGCTGTCTCAACTGAGGATGGAAAATCCTTTGCCGAGAGGGAGTCCCTCTACTTCATGGAAACATCTGCTTTGGAAGCTACTAATGTTGACAATGCATT TGCTGAAGTTCTTAATCAGATCTATAGTATTGTGAGCAAGAAAGCTATGGAGACAGGTGACAATGCAGCAGCTTCAGCTGTTCCATCCAAAGGTGAGAAA ATCGATGTCAATAAAGATGTTTCCGCTATGAAGAGGGTGGGGTGCTGTTCAAGCTAG
AA sequence Show only first row Show all	>Potri.004G061000.1 pacid=42794803 polypeptide=Potri.004G061000.1.p locus=Potri.004G061000 ID=Potri.004G061000.1.v4.1 annot-version=v4.1 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDSKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHST FENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAERESLYFMETSALEATNVDNAFAEVLNQIYSIVSKKAMETGDNAAASAVPSKGEK IDVNKDVSAMKRVGCCSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18800		AthSGBP, AtRab1...	RAB GTPase homolog A1D (.1)		Potri.004G061000 [exp]	0	1
AT2G44525			Protein of unknown function (D...		Potri.014G179500 [exp]	4.24	0.8068
AT3G25580			Thioredoxin superfamily protei...		Potri.001G297900 [exp]	5.29	0.8157
AT3G07190			B-cell receptor-associated pro...		Potri.002G245300 [exp]	6.00	0.8049
AT4G16710			glycosyltransferase family pro...		Potri.005G036500 [exp]	6.48	0.7316
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Potri.014G109100 [exp]	17.34	0.7656
AT3G54650		FBL17	RNI-like superfamily protein (...		Potri.002G044800 [exp]	18.00	0.7637
AT2G43310			Ribosomal L18p/L5e family prot...		Potri.017G030200 [exp]	20.12	0.7741
AT1G06475			unknown protein		Potri.005G203800 [exp]	20.73	0.7572
AT1G47740			PPPDE putative thiol peptidase...		Potri.004G151200 [exp]	21.74	0.7546
AT1G67060			unknown protein		Potri.004G098800 [exp]	22.04	0.6945

Compare expression of checked genes

Potri.004G061000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.