Potri.004G062600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23535 254 / 5e-88 KOW domain-containing protein (.1)
AT5G54600 61 / 1e-11 Translation protein SH3-like family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G415400 62 / 2e-12 AT5G54600 243 / 2e-82 Translation protein SH3-like family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042614 271 / 6e-95 AT5G23535 286 / 6e-101 KOW domain-containing protein (.1)
Lus10022069 269 / 6e-94 AT5G23535 284 / 5e-100 KOW domain-containing protein (.1)
Lus10006905 260 / 2e-90 AT5G23535 280 / 3e-98 KOW domain-containing protein (.1)
Lus10014683 125 / 2e-35 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10005180 65 / 5e-13 AT5G54600 246 / 3e-83 Translation protein SH3-like family protein (.1.2)
Lus10038125 65 / 5e-13 AT5G54600 246 / 6e-83 Translation protein SH3-like family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Potri.004G062600.1 pacid=42795056 polypeptide=Potri.004G062600.1.p locus=Potri.004G062600 ID=Potri.004G062600.1.v4.1 annot-version=v4.1
ATGGGTTGGAAAGCAGCTGAGAAACTGATTAGGCACTGGAAAGTACTCAGAGGAGATAATGTTATGATAATCAGAGGAAAGGATAGAGGTGAGACTGGCG
TTGTTAAGCGTGTCGTTCGCTCTCAAAATCGTGTTATTGTCGAGGGCAAAAATCTGGTGAAAAAGCACATCAAGGCAGGTGAAGGTCATGAAGGTGGAAT
CTTTACTGTTGAAGCCCCACTTCATGCATCAAATGTTCAAGTTGTTGACCCAGTTACAGGGAGGCCATGCAAGGTTGGAATTAGATATCTAGAAGATGGT
ACTAAAGTAAGAGTTTCAAGAGGTGAAGGATCATCTGGGTCCATAATTCCTCGTCCTGAGATTTTAAAGATAAGGACAACTCCAAGACCTACTGTTGCTG
GTCCCAAGGATACCCCAATGGATCTTGTGTTGAAGAAGACATACGATGCTAAAACCGGGAAGGGAATGCCTGACCTGTGA
AA sequence
>Potri.004G062600.1 pacid=42795056 polypeptide=Potri.004G062600.1.p locus=Potri.004G062600 ID=Potri.004G062600.1.v4.1 annot-version=v4.1
MGWKAAEKLIRHWKVLRGDNVMIIRGKDRGETGVVKRVVRSQNRVIVEGKNLVKKHIKAGEGHEGGIFTVEAPLHASNVQVVDPVTGRPCKVGIRYLEDG
TKVRVSRGEGSSGSIIPRPEILKIRTTPRPTVAGPKDTPMDLVLKKTYDAKTGKGMPDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G23535 KOW domain-containing protein ... Potri.004G062600 0 1
AT2G46290 Transducin/WD40 repeat-like su... Potri.010G100101 3.00 0.9366
AT4G14320 Zinc-binding ribosomal protein... Potri.005G092500 8.24 0.9399
AT4G36130 Ribosomal protein L2 family (.... Potri.005G115700 10.19 0.9374 RPL2.2
AT1G74270 Ribosomal protein L35Ae family... Potri.008G059400 11.40 0.9348
AT5G50810 TIM8 translocase inner membrane sub... Potri.015G102000 12.96 0.9045
AT5G48760 Ribosomal protein L13 family p... Potri.001G314500 15.09 0.9332 RPL13.1
AT4G31460 Ribosomal L28 family (.1) Potri.018G006900 15.58 0.8978
AT2G31725 Eukaryotic protein of unknown ... Potri.013G127400 18.16 0.9124
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.005G211200 18.97 0.9356
AT5G11880 Pyridoxal-dependent decarboxyl... Potri.004G157500 19.74 0.9031

Potri.004G062600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.