Potri.004G073100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52740 75 / 2e-18 Copper transport protein family (.1)
AT5G52760 73 / 2e-17 Copper transport protein family (.1)
AT5G52750 67 / 4e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT5G52730 61 / 3e-12 Copper transport protein family (.1)
AT5G52770 56 / 8e-11 Copper transport protein family (.1)
AT1G55790 49 / 4e-08 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2)
AT5G23760 47 / 8e-08 Copper transport protein family (.1)
AT1G63950 45 / 5e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT5G26690 45 / 8e-07 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G073000 142 / 1e-44 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 124 / 1e-37 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 124 / 1e-37 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 109 / 7e-32 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147200 103 / 2e-29 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147000 94 / 1e-25 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 93 / 5e-25 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 89 / 5e-23 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 83 / 9e-21 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028762 99 / 3e-27 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 93 / 3e-25 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 97 / 5e-25 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 92 / 2e-23 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 88 / 9e-23 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 85 / 3e-21 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10017520 83 / 3e-21 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10036395 84 / 9e-21 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039285 82 / 1e-20 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027522 79 / 2e-19 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.004G073100.2 pacid=42796447 polypeptide=Potri.004G073100.2.p locus=Potri.004G073100 ID=Potri.004G073100.2.v4.1 annot-version=v4.1
ATGCAGGAGCACCGCAAAGCTATGTTGAAACTGGATATGCATGATGAGAAAACCAAGAAAAAGGCTATGAAGACAGTCTCTGGTTTCTCAGGGGTGGATT
CAATATCCATGGACTGGAACGACAAGAAATTGACAGTAACAGGCGACATCGACCCAGTAAACATAGTGAAAAAATTGAGAAAGTTTTGTCACGTAGAGAT
AGTTTCTGTAGGAGAAGCAAAAGAGCCTGAAAAGAAAAAAGAAGAGCCAGAGAAACAAGAAGATGAGAAGAAAGATGTTCATCAAAACGTGGATGAGTTG
GCGAGGGCTTACAGGGCCTATTATCCTCACGCGACCATGTATTACCATGTTTCAAGTGTTGAGGATGGTACTAATGCTTGTGTCATTTCTTAA
AA sequence
>Potri.004G073100.2 pacid=42796447 polypeptide=Potri.004G073100.2.p locus=Potri.004G073100 ID=Potri.004G073100.2.v4.1 annot-version=v4.1
MQEHRKAMLKLDMHDEKTKKKAMKTVSGFSGVDSISMDWNDKKLTVTGDIDPVNIVKKLRKFCHVEIVSVGEAKEPEKKKEEPEKQEDEKKDVHQNVDEL
ARAYRAYYPHATMYYHVSSVEDGTNACVIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G01490 Heavy metal transport/detoxifi... Potri.004G073100 0 1
Potri.001G004900 5.38 0.9464
AT2G34930 disease resistance family prot... Potri.015G025100 5.65 0.9308
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Potri.014G106600 8.12 0.9371 COMT4,Pt-RCOMT1.6
Potri.002G252050 14.24 0.9370
AT5G40990 GLIP1 GDSL lipase 1 (.1) Potri.017G134701 15.87 0.8960
Potri.014G003683 16.15 0.9370
Potri.019G073801 17.86 0.9370
AT1G53440 Leucine-rich repeat transmembr... Potri.016G011400 18.65 0.9362
AT4G13440 Calcium-binding EF-hand family... Potri.019G028800 20.83 0.9311
AT4G13440 Calcium-binding EF-hand family... Potri.019G026820 21.56 0.9310

Potri.004G073100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.