Plant FIBer expression Database

Potri.004G074602 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17310 38 / 0.0002 AtUGP2, UGP2 UDP-glucose pyrophosphorylase 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G074400
[exp]
44 / 2e-06 AT5G17310 759 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2)
Potri.004G074750
[exp]
42 / 6e-06 AT5G17310 222 / 2e-72 UDP-glucose pyrophosphorylase 2 (.1.2)
Potri.017G144700
[exp]
40 / 4e-05 AT5G17310 782 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.004G074602.1 pacid=42795086 polypeptide=Potri.004G074602.1.p locus=Potri.004G074602 ID=Potri.004G074602.1.v4.1 annot-version=v4.1
ATGGGATGCACTGGTCCTAGAATGGAGGTTTTGGAGATATATATGACATTGAACTTGATTTATGTTGTTGTGTTTCACAGGTCTGTTTTGGAGATATATA
TGACATTGAACTTGATTTATGTTGTTGTGTTTCTTGACCTTATTGTCATCCAGATTGAGGGAAAAGTGAGCATCGTGGTGAAATCTGGTGTGAAACTGGA
AATACCAGAGGGAGTCGTTCTTGAAAACAAGGAAATTAATGGCCCAGAGGACCTCTAA
AA sequence
>Potri.004G074602.1 pacid=42795086 polypeptide=Potri.004G074602.1.p locus=Potri.004G074602 ID=Potri.004G074602.1.v4.1 annot-version=v4.1
MGCTGPRMEVLEIYMTLNLIYVVVFHRSVLEIYMTLNLIYVVVFLDLIVIQIEGKVSIVVKSGVKLEIPEGVVLENKEINGPEDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G074602
[exp]
0 1
AT5G61620 MYB myb-like transcription factor ... Potri.001G080300
[exp]
8.94 0.8005
AT3G01820 P-loop containing nucleoside t... Potri.012G095700
[exp]
9.74 0.7999
Potri.001G426850
[exp]
14.38 0.7185
AT4G35420 TKPR1, DRL1 tetraketide alpha-pyrone reduc... Potri.008G138600
[exp]
19.39 0.7191
AT5G05130 DNA/RNA helicase protein (.1) Potri.016G034000
[exp]
22.64 0.6507
AT5G60900 RLK1 receptor-like protein kinase 1... Potri.003G211866
[exp]
28.93 0.6260
AT1G70500 Pectin lyase-like superfamily ... Potri.015G088600
[exp]
30.49 0.6260
AT5G55180 O-Glycosyl hydrolases family 1... Potri.016G135900
[exp]
31.00 0.6260
AT5G39130 RmlC-like cupins superfamily p... Potri.004G180100
[exp]
32.74 0.6620
Potri.002G259500
[exp]
35.72 0.6962

Potri.004G074602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.