Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17310 223 / 8e-73 AtUGP2, UGP2 UDP-glucose pyrophosphorylase 2 (.1.2) AT3G03250 220 / 6e-71 AtUGP1, UGP1, UGP UDP-GLUCOSE PYROPHOSPHORYLASE 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G144700 [exp] 242 / 2e-79 AT5G17310 782 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2) Potri.004G074400 [exp] 242 / 2e-79 AT5G17310 759 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2) Potri.013G070001 [exp] 102 / 6e-26 AT3G03250 375 / 9e-124 UDP-GLUCOSE PYROPHOSPHORYLASE 1 (.1) Potri.004G074602 [exp] 42 / 9e-06 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020788 [exp] 231 / 3e-75 AT5G17310 781 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2) Lus10010957 [exp] 223 / 1e-72 AT3G03250 676 / 0.0 UDP-GLUCOSE PYROPHOSPHORYLASE 1 (.1) Lus10007370 [exp] 229 / 2e-72 AT5G17310 785 / 0.0 UDP-glucose pyrophosphorylase 2 (.1.2) Lus10031365 [exp] 223 / 3e-72 AT3G03250 662 / 0.0 UDP-GLUCOSE PYROPHOSPHORYLASE 1 (.1) Lus10041971 [exp] 88 / 6e-21 AT5G17310 332 / 6e-107 UDP-glucose pyrophosphorylase 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0110 [poplar] [flax] GT-A PF01704 [poplar] [flax] UDPGP UTP--glucose-1-phosphate uridylyltransferase
Representative CDS sequence Show only first row Show all	>Potri.004G074750.1 pacid=42795061 polypeptide=Potri.004G074750.1.p locus=Potri.004G074750 ID=Potri.004G074750.1.v4.1 annot-version=v4.1 ATGACATTGAAATTGATTTATGCTGTTGTGTTTCATCGTTCTGGCATTGAAGTTCGTAATGGACTGACATTTCTTGACCTTATTGTCATCCAGATTGAGA ATCTTAACAACAAATATGGGTGCAGCGTTCCCTTGTTTCTAATGAACTCATTCAACACTCATGATGATACACAGAAGATTATTGAGAAGCACTCAAACTC AAATATTGAGATTCACACCTTTAATCAGAGCCAATATCCTCGTCTGGTTGCTGATGATTTTGTGCCAATGCCTTCAAAAGGACACACTGACAAGGATGGA TGGTATCCTCCTGGACATGGTGATTTGTTCCCATCTCTAAAGAACAGTGGCAAGCTTGATGCTTTATTGTCACGGGGTAAAGAGTACTTGTTTGTTGCCA ACCAGGGAACCTCGGTGCTGTTGTTGATTTGA
AA sequence Show only first row Show all	>Potri.004G074750.1 pacid=42795061 polypeptide=Potri.004G074750.1.p locus=Potri.004G074750 ID=Potri.004G074750.1.v4.1 annot-version=v4.1 MTLKLIYAVVFHRSGIEVRNGLTFLDLIVIQIENLNNKYGCSVPLFLMNSFNTHDDTQKIIEKHSNSNIEIHTFNQSQYPRLVADDFVPMPSKGHTDKDG WYPPGHGDLFPSLKNSGKLDALLSRGKEYLFVANQGTSVLLLI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17310		AtUGP2, UGP2	UDP-glucose pyrophosphorylase ...		Potri.004G074750 [exp]	0	1
AT4G25250			Plant invertase/pectin methyle...		Potri.015G128500 [exp]	1.73	0.8635
AT3G23255			unknown protein		Potri.003G163500 [exp]	14.96	0.7491
AT2G42490			Copper amine oxidase family pr...		Potri.010G045600 [exp]	20.63	0.7058
AT5G47530			Auxin-responsive family protei...		Potri.006G015000 [exp]	22.13	0.6930
AT1G36380			unknown protein		Potri.002G090100 [exp]	26.68	0.7832
					Potri.015G073051 [exp]	31.27	0.7925
AT1G09890			Rhamnogalacturonate lyase fami...		Potri.002G110200 [exp]	38.82	0.7741
AT1G29810			Transcriptional coactivator/pt...		Potri.001G352800 [exp]	45.32	0.7560
AT5G19630			alpha/beta-Hydrolases superfam...		Potri.001G013700 [exp]	45.89	0.6305
AT1G07650			Leucine-rich repeat transmembr...		Potri.018G145536 [exp]	46.94	0.7512

Compare expression of checked genes

Potri.004G074750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.