Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03270 243 / 1e-83 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G53990 189 / 3e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 163 / 4e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 82 / 7e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 77 / 4e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G11360 78 / 7e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G62550 75 / 2e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 74 / 4e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 71 / 1e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G01520 66 / 7e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G144301 [exp] 285 / 3e-100 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.006G092700 [exp] 191 / 2e-63 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G104600 [exp] 190 / 1e-62 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 172 / 8e-56 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 84 / 6e-21 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 81 / 1e-19 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 77 / 6e-18 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.013G009800 [exp] 76 / 8e-18 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 74 / 3e-17 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022602 [exp] 185 / 2e-60 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10017207 [exp] 177 / 2e-57 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 175 / 1e-56 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10037761 [exp] 160 / 9e-51 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016900 [exp] 162 / 1e-47 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10021501 [exp] 118 / 8e-35 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034337 [exp] 80 / 2e-19 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 77 / 5e-18 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 76 / 1e-17 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10031594 [exp] 68 / 4e-14 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.004G075375.1 pacid=42794674 polypeptide=Potri.004G075375.1.p locus=Potri.004G075375 ID=Potri.004G075375.1.v4.1 annot-version=v4.1 ATGGAGAACGCACGTACGGTTGGTATCGGCATGGATTACTCTTCTACAAGCAAAGCAGCCCTGCGTTGGGCGGCTGAGAATTTGATAGGTGAAGGCGACC GAATTATTCTGATCCAAGTTCAGCCTCCTAACGCTGATCATACCAGGAAGCAGCTTTTTGGGGGCACTGGATCACCCTTAGTGCCACTCGCGGAATTCAG GGATATCAATTTTTCAAAGCAATACGGGCTTACTTATGATCCTGAAGTTCTTGATATTCTTGATACAGTTTCAAGGACCAAGGGGGCTGAAGTGGTGGCG AAGGTCTACTGGGGAGATCCAAGGGAGAAGTTGATTGATGCTGTGGAAGATCTTAAGTTGGATTCTCTTGTTATGGGAAGTAGGGGTTTAGGTGCTATCA AAAGGGTGTTGCTTGGGAGTGTCAGCAACTACGTGGTGACAAATGCTCCATGTCCAGTCACTGTAGTTAAGGGATCCAAACCTTGA
AA sequence Show only first row Show all	>Potri.004G075375.1 pacid=42794674 polypeptide=Potri.004G075375.1.p locus=Potri.004G075375 ID=Potri.004G075375.1.v4.1 annot-version=v4.1 MENARTVGIGMDYSSTSKAALRWAAENLIGEGDRIILIQVQPPNADHTRKQLFGGTGSPLVPLAEFRDINFSKQYGLTYDPEVLDILDTVSRTKGAEVVA KVYWGDPREKLIDAVEDLKLDSLVMGSRGLGAIKRVLLGSVSNYVVTNAPCPVTVVKGSKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G03270			Adenine nucleotide alpha hydro...		Potri.004G075375 [exp]	0	1
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033600 [exp]	2.44	0.9780
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033400 [exp]	3.46	0.9772
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.018G096500 [exp]	3.87	0.9662
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033500 [exp]	4.47	0.9721
AT5G48100		LAC15, TT10, AT...	TRANSPARENT TESTA 10, LACCASE-...		Potri.005G200500 [exp]	5.29	0.9442
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.001G451300 [exp]	6.00	0.9622
AT5G46080			Protein kinase superfamily pro...		Potri.011G058300 [exp]	7.07	0.9480
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.011G062750 [exp]	9.48	0.9397
AT2G45900			Phosphatidylinositol N-acetygl...		Potri.001G103400 [exp]	9.94	0.9500
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033900 [exp]	13.41	0.9461

Compare expression of checked genes

Potri.004G075375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.