Pt-RPL19.3 (Potri.004G078000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPL19.3
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02780 309 / 3e-108 EMB2386 embryo defective 2386, Ribosomal protein L19e family protein (.1)
AT3G16780 308 / 1e-107 Ribosomal protein L19e family protein (.1)
AT4G02230 307 / 1e-107 Ribosomal protein L19e family protein (.1)
AT4G16030 69 / 3e-15 Ribosomal protein L19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140800 330 / 1e-116 AT3G16780 315 / 2e-110 Ribosomal protein L19e family protein (.1)
Potri.012G037500 324 / 4e-114 AT1G02780 317 / 2e-111 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Potri.015G029500 324 / 4e-114 AT3G16780 309 / 5e-108 Ribosomal protein L19e family protein (.1)
Potri.015G037100 238 / 2e-80 AT1G02780 201 / 5e-66 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016829 312 / 3e-109 AT3G16780 363 / 2e-129 Ribosomal protein L19e family protein (.1)
Lus10038417 306 / 8e-107 AT3G16780 348 / 9e-124 Ribosomal protein L19e family protein (.1)
Lus10038418 300 / 2e-103 AT3G16780 337 / 3e-118 Ribosomal protein L19e family protein (.1)
Lus10023387 308 / 3e-103 AT3G16780 343 / 1e-116 Ribosomal protein L19e family protein (.1)
Lus10037707 295 / 2e-99 AT3G16780 343 / 8e-118 Ribosomal protein L19e family protein (.1)
Lus10023388 281 / 2e-97 AT3G16780 324 / 2e-114 Ribosomal protein L19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01280 Ribosomal_L19e Ribosomal protein L19e
Representative CDS sequence
>Potri.004G078000.1 pacid=42794276 polypeptide=Potri.004G078000.1.p locus=Potri.004G078000 ID=Potri.004G078000.1.v4.1 annot-version=v4.1
ATGGTTTCCCTCAAACTCCAAAAGCGGCTTGCAGCTAGTGTCCTAAAGTGTGGCAAAGGAAAAGTTTGGCTTGACCCGAATGAAGGCAATGAGATCTCCA
TGGCTAATTCACGCCAGAACATAAGGAAGCTTGTGAAGGATGGTTTCATTATCAGAAAGCCAACTAAGATTCACTCTCGGTCCCGCGCTCGACGCATGAA
GGAAGCTAAGAGAAAGGGACGTCACTCTGGCTATGGTAAGCGCAAGGGAACCAGGGAAGCTAGGCTGCCAACAAAGGTCCTCTGGATGAGGAGGATGCGT
GTTTTAAGGCGTCTTCTTCGCAAGTATCGCGAGTCAAAGAAGATTGACAAGCACATGTACCATGACATGTACATGAAGGTGAAGGGTAATGTGTTCAAGA
ACAAGAGAGTTCTAATGGAAAGCATCCACAAATCAAAGGCAGAGAAGGCTAGGGAGAAGACTTTGTCCGATCAATTTGAGGCTAAGCGGGCAAAGAACAA
GGCTAGCAGGGAGAGGAAATTTGCTAGGAGGGAAGAACGATTAGCCATGGGACCTGGGGCAGAAAAGCCAGTAGCTGCACCACCCGCTGCTGTTTCTCAA
CCAGCAGAGGGAACTAAGAAGTCCAAGAAGTGA
AA sequence
>Potri.004G078000.1 pacid=42794276 polypeptide=Potri.004G078000.1.p locus=Potri.004G078000 ID=Potri.004G078000.1.v4.1 annot-version=v4.1
MVSLKLQKRLAASVLKCGKGKVWLDPNEGNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKVLWMRRMR
VLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKFARREERLAMGPGAEKPVAAPPAAVSQ
PAEGTKKSKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G02780 EMB2386 embryo defective 2386, Ribosom... Potri.004G078000 0 1 Pt-RPL19.3
AT5G08170 ATAIH, EMB1873 EMBRYO DEFECTIVE 1873, AGMATIN... Potri.015G055300 1.73 0.8723
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Potri.010G162600 2.82 0.8277
AT3G21820 SDG36, ATXR2 SET DOMAIN PROTEIN 36, histone... Potri.017G038700 2.82 0.8128 SDG943
AT1G47820 unknown protein Potri.014G121300 3.87 0.8207
AT3G16640 TCTP translationally controlled tum... Potri.008G221200 4.24 0.8190
AT3G16640 TCTP translationally controlled tum... Potri.010G013400 4.69 0.8410 Pt-TCTP.2
AT3G05700 Drought-responsive family prot... Potri.013G011200 7.93 0.8329
AT1G45976 SBP1 S-ribonuclease binding protein... Potri.002G124700 9.38 0.8001
AT2G20480 unknown protein Potri.001G009501 10.39 0.7528
AT1G02870 unknown protein Potri.014G130400 11.22 0.8151

Potri.004G078000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.